Recombinant Putative protein-disulfide oxidoreductase (STY3372, t3114)

Shipped with Ice Packs
In Stock

Description

Functional Role

As a putative protein-disulfide oxidoreductase, STY3372 is hypothesized to:

  • Catalyze disulfide bond formation, isomerization, or reduction in substrate proteins .

  • Participate in redox homeostasis, akin to other thioredoxin-like enzymes .

  • Potentially assist in the oxidative folding of virulence factors in S. typhi, though direct evidence remains to be established .

Production and Purification

ParameterDetail
Expression SystemEscherichia coli
TagN-terminal His-tag
Purity>95% (SDS-PAGE)
Formulation20 mM Tris-HCl (pH 7.5), 2 mM EDTA
StorageStable at -80°C; avoid freeze-thaw cycles
Data sourced from .

Research Applications

  • Enzymatic Assays: Study substrate specificity using redox activity assays (e.g., insulin reduction or glutathione equilibration) .

  • Structural Studies: Analyze crystal structures to map active-site residues and conformational dynamics .

  • Pathogenicity Studies: Investigate its role in S. typhi virulence by gene knockout or overexpression .

Comparative Analysis with Homologs

FeatureSTY3372 (S. typhi)PfPDO (P. furiosus)DsbA (E. coli)
Active SiteCXXC motifCPYC and CXXC motifs CXXC motif
ThermostabilityNot reportedHyperthermostable Mesophilic
Redox PartnersUnknownThioredoxin reductase DsbB
FunctionPutative oxidoreductaseOxidase/isomerase Oxidase

Unresolved Questions and Future Directions

  • Substrate Identification: High-throughput screening to identify physiological targets in S. typhi.

  • Mechanistic Studies: Clarify whether STY3372 operates as an oxidase, reductase, or isomerase .

  • Structural Insights: Resolve 3D structures to compare with homologs like DsbA or ERp18 .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you require a specific format, please indicate your preference in the order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your needs.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple use, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
dsbI; STY3372; t3114; Protein-disulfide oxidoreductase DsbI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Salmonella typhi
Target Names
dsbI
Target Protein Sequence
MDFIKGLWRDLRARPVDTLVRWQEQRFLWLLMAIAMGGLIILAHSFFQIYLYMAPCEQCV YIRYAMFVMVIGGVIAAINPKNIVLKLIGCIAAFYGSIMGIKFSIKLNGIHHAVHNADPD SLFGVQGCSTDPTFPFNLPLAEWAPEWFKPTGDCGYDAPIVPDGVTLSSVQQWFVDLYQQ SEGWYLLPPWHFMNMAQACMLAFGLCLILLLVMSGAWALKLARGK
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in some proteins. It is part of a redox system composed of DsbI and DsbL, which mediates the formation of an essential disulfide bond in AssT.
Database Links

KEGG: stt:t3114

STRING: 220341.STY3372

Protein Families
DsbB family, DsbI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the structure of STY3372 compare to other protein disulfide oxidoreductases?

Structurally, STY3372 shares characteristics with the broader family of protein disulfide oxidoreductases while maintaining distinct features. Like many PDOs, STY3372 contains the critical CXXC active site motifs essential for catalytic activity. The protein adopts a structure with two thioredoxin-related units that together form a closed protein domain, similar to the arrangement observed in other PDOs from various organisms .

The thioredoxin-like domains in STY3372 create specific substrate-binding grooves on the protein surface, which facilitate interactions with target proteins. Unlike some other oxidoreductases, such as DsbA from E. coli, STY3372 contains membrane-spanning regions, suggesting it functions at the membrane interface rather than exclusively in the periplasmic space. This membrane association likely influences its substrate specificity and functional role in Salmonella typhi compared to soluble oxidoreductases .

When compared to the homologous protein from Escherichia coli O6:K15:H31 (ECP_3132), STY3372 shows high sequence similarity but contains specific amino acid variations that may affect substrate specificity and catalytic efficiency. These structural differences likely evolved to accommodate the specific proteome and pathogenic lifestyle of Salmonella typhi .

What are the recommended reconstitution and storage conditions for experimental use?

For optimal experimental results with Recombinant Putative protein-disulfide oxidoreductase (STY3372, t3114), the following reconstitution and storage protocols are recommended:

Reconstitution Protocol:

  • Centrifuge the vial briefly before opening to collect the contents at the bottom.

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (50% is typically recommended) to stabilize the protein.

  • Prepare small working aliquots to minimize freeze-thaw cycles.

Storage Conditions:

  • Store reconstituted aliquots at -20°C/-80°C for long-term storage.

  • Working aliquots can be stored at 4°C for up to one week.

  • Avoid repeated freeze-thaw cycles as they can compromise protein activity and stability.

  • The reconstituted protein is typically stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

Researchers should validate protein stability and activity after reconstitution by performing activity assays specific to disulfide oxidoreductases before incorporating the protein into experimental workflows.

What experimental approaches can be used to characterize the catalytic activity of STY3372?

Characterizing the catalytic activity of STY3372 requires specialized approaches targeting its oxidoreductase function. The following methodological approaches are recommended:

Disulfide Reduction Assay:
This assay measures the protein's ability to reduce disulfide bonds using substrates like insulin or DTNB (5,5'-dithiobis-(2-nitrobenzoic acid)). The reduction of disulfide bonds in insulin causes precipitation that can be monitored spectrophotometrically at 650 nm, while DTNB reduction produces TNB that absorbs at 412 nm .

Disulfide Isomerization Assay:
To assess isomerase activity, researchers can use RNase A with scrambled disulfide bonds as a substrate. Reactivation of RNase A occurs when STY3372 correctly isomerizes the disulfide bonds, and activity can be measured using standard RNase substrates .

Oxidative Folding Assay:
This approach evaluates the protein's ability to introduce disulfide bonds into reduced substrates. Reduced proteins lacking disulfide bonds are incubated with STY3372, and the formation of correctly folded disulfide bonds is monitored by analytical techniques such as non-reducing SDS-PAGE or enzyme activity measurements if the substrate is an enzyme .

Table 1: Recommended Assays for Catalytic Activity Characterization

Assay TypeSubstrateMeasurementDetection MethodKey Controls
ReductionInsulin or DTNBDisulfide reductionTurbidity (650 nm) or absorbance (412 nm)DTT (positive), buffer (negative)
IsomerizationScrambled RNase ARNase activity recoveryRNA degradation assayNative RNase A (positive)
OxidationReduced proteinsDisulfide formationNon-reducing SDS-PAGE, MS analysisAir oxidation (negative)
Redox couplingThioredoxin/glutaredoxinElectron transferNADPH oxidation (340 nm)Without STY3372 (negative)

These assays should be performed under varying conditions (pH, temperature, salt concentration) to determine the optimal parameters for STY3372 activity and to compare its catalytic properties with other disulfide oxidoreductases .

How can researchers investigate the potential physiological substrates of STY3372 in Salmonella typhi?

Identifying the physiological substrates of STY3372 in Salmonella typhi represents a significant challenge in understanding its biological role. Several complementary approaches can be employed:

Genetic Knockout Studies:
Create STY3372 deletion mutants in Salmonella typhi and perform comparative proteomics to identify proteins with altered disulfide bond patterns. This approach can reveal potential substrates whose proper folding depends on STY3372 activity. Special attention should be paid to periplasmic and membrane proteins, as these are common targets for bacterial disulfide oxidoreductases .

Trapping Mutant Approach:
Design STY3372 variants with mutations in the resolving cysteine of the CXXC motif, which can form stable mixed disulfides with substrate proteins. These intermediates can be isolated through affinity purification (utilizing the His-tag) followed by mass spectrometry identification of the trapped proteins .

Substrate Prediction and Validation:
Analyze the Salmonella typhi proteome for proteins containing multiple cysteines, particularly those localized to the same cellular compartment as STY3372. Recombinantly express these candidate substrates and perform in vitro oxidative folding assays with purified STY3372 to validate the interaction .

Co-immunoprecipitation and Crosslinking:
Utilize antibodies against STY3372 or its His-tag for co-immunoprecipitation experiments. Alternatively, employ chemical crosslinking reagents that can capture transient enzyme-substrate interactions before performing pull-down experiments and mass spectrometry analysis .

Table 2: Predicted Substrate Properties Based on Characterized Disulfide Oxidoreductases

PropertyTypical Characteristics for STY3372 SubstratesDetection Methods
LocalizationPeriplasmic or membrane-associated proteinsCellular fractionation, GFP fusion localization
Cysteine contentMultiple cysteines with potential to form disulfide bondsSequence analysis, mass spectrometry
Structural featuresDomains requiring disulfide bonds for stabilityCD spectroscopy, thermal stability assays
Functional categoriesVirulence factors, stress response proteins, transportersFunctional enrichment analysis
Evolutionary conservationConservation of cysteine pairs across EnterobacteriaceaeComparative genomics

Researchers should consider that STY3372 may have substrate specificity distinct from other characterized oxidoreductases like DsbA due to its membrane association and specific structural features .

What role might STY3372 play in Salmonella typhi virulence and pathogenesis?

The potential role of STY3372 in Salmonella typhi virulence represents an important research question with implications for understanding typhoid fever pathogenesis. Several experimental approaches can help elucidate this relationship:

Infection Models:
Compare the virulence of wild-type Salmonella typhi with STY3372 deletion mutants in appropriate infection models. Since S. typhi is human-specific, humanized mouse models or cell culture systems may be necessary. Measure bacterial colonization, survival within macrophages, and host immune responses to assess virulence attenuation .

Virulence Factor Analysis:
Evaluate the impact of STY3372 deletion on known S. typhi virulence factors that contain disulfide bonds, such as components of type III secretion systems, adhesins, and toxins. Proper folding and function of these proteins often depend on correct disulfide bond formation .

Oxidative Stress Resistance:
Assess the role of STY3372 in protecting S. typhi against oxidative stress encountered during infection. This can be tested by exposing wild-type and mutant strains to hydrogen peroxide, reactive nitrogen species, or activated macrophages and measuring survival rates .

Protein Secretion Analysis:
Examine whether STY3372 disruption affects the secretion and function of proteins involved in host-pathogen interactions. This can be done by analyzing the protein composition of culture supernatants from wild-type and mutant strains using proteomics approaches .

Table 3: Potential STY3372-Dependent Virulence Mechanisms in Salmonella typhi

Virulence MechanismPotential Role of STY3372Experimental Approach
Type III secretionEnsuring proper folding of secretion apparatus componentsSecretion assays, electron microscopy
Adhesion to host cellsMaintaining structural integrity of adhesinsAdhesion assays, biofilm formation tests
Intracellular survivalSupporting proteins involved in resistance to antimicrobial peptidesMacrophage survival assays
Toxin productionFacilitating correct folding of toxins with disulfide bondsToxicity assays on host cells
Stress responseContributing to oxidative stress resistanceSurvival under oxidative stress conditions

Understanding STY3372's role in virulence could potentially identify new targets for antimicrobial development or attenuated vaccine strains against typhoid fever .

How do the CXXC active site motifs in STY3372 contribute to its catalytic mechanism?

The CXXC motifs in STY3372 are fundamental to its function as a disulfide oxidoreductase. Based on structural and functional studies of related proteins, we can deduce the following about STY3372's catalytic mechanism:

The CXXC motif (where X represents any amino acid) contains two cysteine residues that cycle between oxidized (disulfide) and reduced (dithiol) states during catalysis. In STY3372, the specific sequence of this motif can be identified in the amino acid sequence as "CEQC" based on the provided sequence data .

The catalytic mechanism proceeds through the following steps:

  • The N-terminal cysteine of the CXXC motif, which typically has a lower pKa value, initiates nucleophilic attack on the substrate disulfide bond.

  • This results in the formation of a mixed disulfide intermediate between the enzyme and substrate.

  • The C-terminal cysteine of the CXXC motif then attacks this mixed disulfide, releasing the substrate with altered disulfide configuration and returning the enzyme to its original state.

The amino acids between the two cysteines (EQ in the case of CEQC) influence the redox potential of the active site, determining whether the protein preferentially acts as an oxidase, reductase, or isomerase. The observed "EQ" dipeptide in STY3372 suggests specific redox properties that would need to be experimentally determined .

STY3372 likely possesses two grooves on its surface near the CXXC motifs that facilitate substrate binding, similar to other characterized PDOs from hyperthermophiles. These grooves provide the structural basis for substrate recognition and may exhibit different redox properties, allowing for sequential reactions in protein disulfide shuffling .

What insights can be gained from comparative analysis of STY3372 with related bacterial disulfide oxidoreductases?

Comparative analysis of STY3372 with related bacterial disulfide oxidoreductases reveals important insights into its potential functions and evolutionary adaptations:

Functional Divergence:
The presence of membrane-spanning regions in STY3372, unlike classical PDIs and some bacterial DsbA proteins, indicates potential specialization in handling membrane or membrane-associated substrates. This structural arrangement may facilitate interactions with integral membrane proteins that require disulfide bond formation during their biogenesis .

Evolution and Adaptation:
Sequence alignment of STY3372 with homologs from other Enterobacteriaceae reveals conserved and variable regions that reflect evolutionary pressures. The conservation of CXXC motifs across species underscores their essential catalytic role, while variations in substrate-binding regions may reflect adaptation to different bacterial proteomes and physiological requirements .

Table 4: Comparison of STY3372 with Related Bacterial Disulfide Oxidoreductases

FeatureSTY3372 (S. typhi)ECP_3132 (E. coli O6:K15:H31)DsbA (E. coli K-12)
Length225 aa223 aa208 aa
CXXC motifPresent (CEQC)Present (CEQC)Present (CPHC)
Membrane associationTransmembrane regionsTransmembrane regionsSoluble periplasmic
Substrate scopeUnknown, likely membrane proteinsUnknown, likely membrane proteinsPeriplasmic proteins (PhoA, OmpA, pilus)
Redox partnerUnknownUnknownDsbB
Primary functionPutative disulfide formation/isomerizationPutative disulfide formation/isomerizationDisulfide bond formation

This comparative analysis highlights that while STY3372 belongs to the broader family of disulfide oxidoreductases, its specific structural features suggest specialized functions that may be particularly important for Salmonella typhi biology and pathogenesis .

What are the optimal conditions for enhancing the solubility and stability of recombinant STY3372 during purification?

Enhancing the solubility and stability of recombinant STY3372 during purification requires careful optimization of expression and purification conditions due to its membrane-associated nature. The following methodological approach is recommended:

Expression Optimization:

  • Expression temperature: Lower temperatures (16-20°C) often improve folding of membrane-associated proteins compared to standard 37°C induction.

  • Inducer concentration: Titrate IPTG concentration (0.1-1.0 mM) to find optimal expression levels that balance yield and solubility.

  • Expression host selection: Consider specialized E. coli strains designed for membrane protein expression (C41, C43) or those with enhanced disulfide bond formation capability (SHuffle, Origami).

  • Co-expression with chaperones: Co-express with molecular chaperones like GroEL/GroES or DsbC to improve folding .

Solubilization and Purification Strategy:

  • Membrane fraction isolation: Use differential centrifugation to isolate membrane fractions containing STY3372.

  • Detergent screening: Test multiple detergents (DDM, LDAO, Triton X-100, CHAPS) at various concentrations to identify optimal solubilization conditions.

  • Buffer optimization: Include reducing agents (1-5 mM DTT or β-mercaptoethanol) during initial purification steps to prevent non-specific disulfide formation, followed by controlled oxidation if required for activity.

  • Additives for stability: Include glycerol (10-20%), trehalose (5-10%), or specific lipids that might enhance stability of membrane-associated regions .

Table 5: Recommended Purification Conditions for Recombinant STY3372

ParameterRecommended ConditionsRationale
Expression temperature18°C, 16-20 hours post-inductionSlower expression favors proper folding
Cell lysis buffer50 mM Tris pH 8.0, 150 mM NaCl, 10% glycerol, 1 mM PMSF, protease inhibitorsStabilizes protein during initial extraction
Solubilization1% DDM or 1% LDAO, gentle agitation, 4°C, 1-2 hoursMild detergents preserve structure
IMAC purification20 mM Tris pH 8.0, 300 mM NaCl, 0.05% detergent, 20-250 mM imidazole gradientHis-tag purification with detergent maintenance
Size exclusion20 mM Tris pH 8.0, 150 mM NaCl, 0.02% detergent, 5% glycerolFinal polishing and buffer exchange
Storage conditionsAdd 50% glycerol, flash freeze in liquid nitrogen, store at -80°CPreserves activity during storage

Researchers should validate protein quality through analytical techniques such as dynamic light scattering, thermal shift assays, and activity measurements before proceeding with functional studies .

How can researchers effectively study the interaction between STY3372 and its potential redox partners?

Studying the interaction between STY3372 and its potential redox partners requires specialized approaches that capture these often transient redox-based interactions. The following methodological framework is recommended:

Identification of Potential Redox Partners:

  • Genomic context analysis: Examine genes in proximity to STY3372 in the Salmonella typhi genome, as redox partners are often co-localized or co-transcribed.

  • Homology-based prediction: Based on known redox pairs in E. coli (e.g., DsbA-DsbB), identify homologous proteins in S. typhi.

  • Redox proteomics: Use diagonal electrophoresis approaches to identify proteins that form mixed disulfides with STY3372 in vivo .

Interaction Characterization Approaches:

  • Trapping mutants: Generate STY3372 variants with the second cysteine of the CXXC motif mutated to alanine or serine to stabilize mixed disulfide intermediates with redox partners.

  • Bimolecular Fluorescence Complementation (BiFC): Split fluorescent protein assays can visualize interactions in bacterial cells.

  • Surface Plasmon Resonance (SPR): Measure binding kinetics and affinity constants between purified STY3372 and potential partners.

  • Isothermal Titration Calorimetry (ITC): Determine thermodynamic parameters of interactions .

Functional Validation of Redox Transfer:

  • Redox state monitoring: Use AMS or PEG-maleimide labeling to track changes in the redox state of STY3372 upon interaction with putative partners.

  • Electron transfer assays: Couple redox reactions to measurable outputs (e.g., NADPH oxidation) to monitor electron flow between STY3372 and partners.

  • Reconstitution experiments: Reconstitute the complete redox pathway in liposomes or nanodiscs to mimic the native membrane environment .

Table 6: Methods for Studying STY3372 Redox Interactions

MethodApplicationAdvantagesLimitations
Cysteine trappingCapturing mixed disulfidesIdentifies direct redox partnersMay alter protein function
Redox proteomicsLarge-scale partner identificationUnbiased approachComplex data analysis
SPRBinding kinetics measurementReal-time interaction dataRequires pure protein samples
ITCThermodynamic characterizationDirect measurement of binding energeticsHigh protein consumption
AMS/PEG-maleimide labelingRedox state monitoringSimple visualization of redox changesIndirect measure of interaction
Liposome/nanodisc reconstitutionFunctional validationMimics native membrane environmentTechnical complexity

Researchers should consider that the membrane-associated nature of STY3372 may require specialized techniques that accommodate detergent-solubilized or membrane-embedded proteins for accurate interaction studies .

What approaches can be used to develop inhibitors or modulators of STY3372 activity for research purposes?

Developing inhibitors or modulators of STY3372 activity requires a strategic approach combining structural insights with screening methodologies. The following systematic approach is recommended:

Structure-Based Design:

  • Homology modeling: If a crystal structure of STY3372 is unavailable, create a homology model based on structurally characterized homologs.

  • Active site analysis: Identify key residues involved in catalysis, particularly the CXXC motif and substrate-binding regions.

  • Virtual screening: Perform in silico docking of compound libraries against the active site to identify potential binding molecules.

  • Fragment-based approach: Identify small molecular fragments that bind to different regions of the active site and link them to create high-affinity inhibitors .

High-Throughput Screening (HTS):

  • Activity-based assays: Develop fluorescence or colorimetric assays based on disulfide reduction, oxidation, or isomerization that can be miniaturized for HTS format.

  • Compound libraries: Screen diverse chemical libraries, including natural product collections, known redox-active compounds, and peptidomimetics.

  • Thiol-reactive compounds: Test electrophilic compounds that can form covalent adducts with the active site cysteines .

Rational Design Strategies:

  • Substrate mimetics: Design peptides or peptidomimetics based on identified STY3372 substrates that can competitively bind to the active site.

  • Redox-inactive analogs: Develop compounds that mimic the redox cofactors but lack electron transfer capability.

  • Allosteric modulators: Target non-catalytic regions that can influence enzyme conformation and activity .

Table 7: Assay Systems for STY3372 Inhibitor Screening

Assay TypePrincipleDetection MethodAdvantages for Screening
DTNB reductionMeasures disulfide reduction activityAbsorbance (412 nm)Simple, inexpensive, adaptable to HTS
Fluorescent peptide substratesQuenching release upon disulfide modificationFluorescenceHigh sensitivity, real-time monitoring
RNase refoldingMeasures isomerase activityRNA degradationFunctional readout of complex activity
Thermal shiftCompound binding stabilizes proteinFluorescenceDetects binders without activity requirement
Surface plasmon resonanceDirect measurement of bindingRefractive index changesLabel-free, provides kinetic information

Once potential inhibitors are identified, they should be characterized for specificity against related oxidoreductases, mechanism of action (competitive, non-competitive, or irreversible), and cellular activity in bacterial systems. The most promising compounds can serve as valuable research tools for probing STY3372 function in cellular contexts .

What are the major unresolved questions regarding STY3372 function in Salmonella typhi biology?

Despite progress in characterizing protein disulfide oxidoreductases, significant knowledge gaps remain regarding STY3372's precise role in Salmonella typhi biology. The following represent critical unresolved questions that merit further investigation:

Physiological Substrates:
The specific proteins that depend on STY3372 for proper disulfide bond formation remain largely unknown. Identifying these substrates is crucial for understanding STY3372's biological role and potential impact on virulence. This gap limits our understanding of which cellular processes are most affected by STY3372 activity .

Redox Partnership Network:
The complete redox pathway involving STY3372 remains unclear. While DsbB serves as a redox partner for DsbA in E. coli, the equivalent redox cycling system for STY3372 in S. typhi has not been fully elucidated. Understanding this network is essential for comprehending how STY3372 maintains its catalytic cycle .

Regulatory Mechanisms:
How STY3372 expression and activity are regulated in response to environmental signals, particularly those encountered during infection, remains poorly understood. Potential transcriptional, post-transcriptional, or post-translational regulatory mechanisms have not been thoroughly investigated .

Membrane Association Significance:
The functional importance of STY3372's membrane association, in contrast to soluble disulfide oxidoreductases, requires clarification. Whether this localization enables specific interactions with membrane proteins or provides compartmentalization advantages remains speculative .

Table 8: Critical Knowledge Gaps in STY3372 Research

Research AreaCurrent KnowledgeKey Unresolved Questions
Substrate specificityGeneral function as disulfide oxidoreductaseWhich specific S. typhi proteins require STY3372?
Redox partnersLikely works within a redox networkWhat proteins reoxidize STY3372 after catalysis?
RegulationExpression detectedHow is STY3372 regulated during infection and stress?
Structural detailsPrimary sequence knownWhat is the 3D structure and active site architecture?
Pathogenesis rolePutative involvementHow does STY3372 contribute to virulence?
RedundancyOne of several disulfide oxidoreductasesIs there functional overlap with other oxidoreductases?

Addressing these questions would significantly advance our understanding of STY3372's role in S. typhi biology and potentially reveal new avenues for therapeutic intervention against typhoid fever .

How might advances in structural biology techniques contribute to a better understanding of STY3372?

Advances in structural biology techniques offer promising opportunities to enhance our understanding of STY3372's function and mechanisms. The following approaches represent valuable directions for future research:

Cryo-Electron Microscopy (Cryo-EM):
Recent developments in cryo-EM allow structural determination of membrane proteins in their native-like environment without crystallization. This technique could reveal STY3372's structure in complex with membrane components, providing insights into how its membrane association influences function. Single-particle cryo-EM or tomography could capture different conformational states during the catalytic cycle .

Integrative Structural Biology:
Combining multiple techniques such as X-ray crystallography, NMR spectroscopy, and computational modeling can provide complementary structural information. While crystallography might capture the soluble domains, NMR could provide dynamics information, and computational methods could integrate these data into a comprehensive structural model that includes the membrane-spanning regions .

Time-Resolved Structural Studies:
Emerging techniques for time-resolved structural biology (e.g., time-resolved X-ray crystallography or time-resolved cryo-EM) could capture transient intermediates during catalysis, revealing the structural transitions that occur during disulfide bond formation, reduction, or isomerization .

In-Cell Structural Biology:
Methods for structural determination within cellular environments, such as in-cell NMR or cellular cryo-electron tomography, could reveal how STY3372's structure and interactions are influenced by the native bacterial environment .

Table 9: Structural Biology Approaches for STY3372 Research

These advanced structural approaches would provide unprecedented insights into how STY3372's structure facilitates its catalytic function, substrate specificity, and interactions with redox partners, potentially guiding the development of specific inhibitors or activity modulators .

What potential applications might emerge from a deeper understanding of STY3372 function?

A comprehensive understanding of STY3372 function could lead to several innovative applications spanning medical, biotechnological, and basic research domains:

Antimicrobial Development:
By targeting STY3372 function, researchers could develop novel antimicrobials specific to Salmonella typhi. If STY3372 proves essential for pathogenesis or bacterial survival, inhibitors could serve as lead compounds for drug development. Since disulfide bond formation is often critical for bacterial virulence factors, such inhibitors might reduce pathogenicity without necessarily killing bacteria, potentially reducing selective pressure for resistance development .

Attenuated Vaccine Development:
Engineered S. typhi strains with modified STY3372 could potentially serve as attenuated live vaccine candidates against typhoid fever. If STY3372 mutation reduces virulence while maintaining immunogenicity, such strains could provide protective immunity without causing disease .

Biotechnological Applications:
The catalytic properties of STY3372 could be harnessed for biotechnological applications requiring disulfide bond formation or isomerization. Potential applications include:

  • Improved production of disulfide-rich proteins in recombinant expression systems

  • Development of enzyme-based biosensors for detecting redox changes

  • Biocatalysts for chemical synthesis requiring selective disulfide bond formation

Research Tools:
Engineered variants of STY3372 could serve as research tools for:

  • Identifying proteins containing structural or catalytic disulfide bonds

  • Probing redox environments within bacterial cells

  • Studying protein folding pathways dependent on disulfide bond formation

Table 10: Potential Applications of STY3372 Research

Application AreaSpecific ApplicationsRequirements for Development
Antimicrobial developmentInhibitors targeting virulenceHigh-throughput screening, structure-based design
Vaccine developmentAttenuated S. typhi strainsGenetic engineering, immunogenicity testing
Protein productionEnhanced disulfide-bond formationEnzyme engineering, expression system optimization
BiosensorsRedox-sensitive detection systemsProtein immobilization, signal amplification
BiocatalysisSelective oxidation reactionsSubstrate specificity engineering
Research toolsRedox biology investigationSpecificity, stability, and detection improvements

The development of these applications would require interdisciplinary approaches combining structural biology, protein engineering, microbiology, and medicinal chemistry, highlighting the translational potential of fundamental research on STY3372 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.