Recombinant Putative transport permease ycf38 (ycf38)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycf38; Putative transport permease ycf38; ORF291
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Porphyra purpurea (Red seaweed) (Ulva purpurea)
Target Names
ycf38
Target Protein Sequence
MTFAFSKKIELKPILKFDTPKVYSYEIIQEIEALVQRLFLQVWRRPATLMAGIIQPLLWL
VLFGGLFCNAPVNLFTINTSYNRFLSSGIIVFTSFTGALNSGLPLMFDREFGFLNRLLTA
PLISRTSIIFSSATFMTCLSLIQVIFIVIASLFMGNSPLSSNSTLIFALIVLLVTVGVTM
LSLALSFTLPGHIELLALILVVNLPFLFSSTALAPLYFMPPWLQLIASLNPLSYAIEGIR
YIYSNTDWNFTESVIKISWGDISLGQIISLLLFLDVIGAYIVSNILKARLN
Uniprot No.
Target Background
Protein Families
ABC-2 integral membrane protein family
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
