Recombinant Putative tyrosine-protein kinase in cps region

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Putative Tyrosine-Protein Kinase in cps region

Recombinant Putative Tyrosine-Protein Kinase in cps region refers to a protein that belongs to the tyrosine kinase family, which has been produced using recombinant DNA technology. Tyrosine kinases are enzymes that play a crucial role in cell signaling pathways by catalyzing the transfer of a phosphate group from ATP to tyrosine residues on target proteins . This phosphorylation can alter the activity, localization, or interaction of the target proteins, thereby regulating various cellular processes such as cell growth, differentiation, metabolism, and immune responses . The "cps region" refers to the capsular polysaccharide synthesis region in bacteria, indicating that this particular tyrosine kinase is associated with the production of capsular polysaccharides (EPS) . EPS is essential for the virulence of many pathogens .

Characteristics of Tyrosine-Protein Kinases

Tyrosine-protein kinases (PTKs) represent a key family of enzymes involved in signal transduction pathways. They catalyze the phosphorylation of tyrosine residues on target proteins, a process crucial for regulating cell growth, differentiation, and other essential cellular functions . PTKs can be broadly classified into two main groups: receptor tyrosine kinases (RTKs) and non-receptor tyrosine kinases.

  • Receptor Tyrosine Kinases (RTKs): These kinases are transmembrane receptors with an extracellular ligand-binding domain and an intracellular kinase domain. Upon ligand binding, RTKs dimerize and autophosphorylate, initiating downstream signaling cascades .

  • Non-Receptor Tyrosine Kinases: These kinases are located within the cell and are activated by various stimuli, including receptor activation, cellular stress, or changes in the cellular environment .

Role in Capsular Polysaccharide (CPS) Production

The presence of a tyrosine-protein kinase in the capsular polysaccharide synthesis (cps) region suggests its involvement in the regulation of EPS production. EPS is a crucial component for bacterial pathogens, contributing to their virulence by aiding in adhesion, biofilm formation, and protection against the host's immune system .

  • Regulation of EPS Production: Studies indicate that tyrosine kinases within the cps region, such as Etk in E. coli, are essential for EPS production . Mutants lacking these kinases often show defects in EPS synthesis, highlighting their regulatory role.

  • Molecular Switch Mechanism: The interplay between protein tyrosine kinases (PTKs) and protein tyrosine phosphatases (PTPs) appears to form a molecular switch that regulates EPS production. Phosphorylation and dephosphorylation, mediated by PTKs and PTPs respectively, govern this switch .

Examples and Research Findings

Several studies have highlighted the presence and function of tyrosine-protein kinases in various bacterial species:

  • Escherichia coli (E. coli): The tyrosine kinase Etk in E. coli is involved in EPS production and is regulated by a corresponding tyrosine phosphatase. The etk gene encodes an inner membrane protein that catalyzes tyrosine autophosphorylation and phosphorylation .

  • Streptococcus suis (S. suis): In Streptococcus suis, Stk1 is linked to CPS synthesis. Stk1 phosphorylates CcpS, modulating the activity of phosphatase CpsB and altering CpsD phosphorylation, which in turn modulates the expression of the Wzx-Wzy pathway and thus CPS production .

Methods for Studying Recombinant Tyrosine Kinases

Several methods are employed to study recombinant tyrosine kinases, including:

  • Recombinant Expression: Expressing the kinase in a heterologous system (e.g., E. coli) to produce large quantities of the protein for in vitro studies .

  • Phosphorylation Assays: In vitro assays to measure the kinase activity by monitoring the phosphorylation of substrate proteins .

  • Structural Analysis: Techniques such as X-ray crystallography and NMR spectroscopy to determine the three-dimensional structure of the kinase .

  • Mutational Analysis: Creating mutant versions of the kinase to study the function of specific domains or residues .

Implications for Pathogenesis and Drug Development

Understanding the role of recombinant putative tyrosine-protein kinases in bacterial pathogens has significant implications for developing new therapeutic strategies:

  • Target for Antibacterial Drugs: Inhibiting these kinases could disrupt EPS production, thereby reducing bacterial virulence and biofilm formation .

  • Structure-Based Drug Design: Knowing the structure of these kinases allows for the design of specific inhibitors that bind to the ATP-binding site or other regulatory domains .

Tables and Data

Table 1: Examples of Tyrosine Kinases in EPS Production

Bacterial SpeciesTyrosine KinaseRole in EPS Production
Escherichia coliEtkCatalyzes tyrosine autophosphorylation and phosphorylation; involved in EPS production.
Streptococcus suisStk1Phosphorylates CcpS, modulating the activity of phosphatase CpsB, which alters CpsD phosphorylation, modulating the expression of the Wzx-Wzy pathway and thus CPS production .
A. johnsoniiPtkInvolved in EPS production and regulated by a tyrosine phosphatase .
R. melilotiExoPInvolved in regulating or orchestrating the delivery of the EPS repeating units from the cytoplasm to the extracellular cell surface .

Table 2: Methods for Studying Tyrosine Kinases

MethodDescription
Recombinant ExpressionExpressing the kinase in a heterologous system to produce large quantities of the protein .
Phosphorylation AssaysIn vitro assays to measure the kinase activity by monitoring the phosphorylation of substrate proteins .
Structural AnalysisTechniques such as X-ray crystallography and NMR spectroscopy to determine the three-dimensional structure of the kinase .
Mutational AnalysisCreating mutant versions of the kinase to study the function of specific domains or residues .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Putative tyrosine-protein kinase in cps region; ORF6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-722
Protein Length
full length protein
Species
Klebsiella pneumoniae
Target Protein Sequence
MTSISKKKQPETVDDLDFGRMVGELIDHRKIIIALTSFATLIALLYAFFATPIYKADALI QVEQKQANAILSNLSQMLPDSQPQSAPEIALIQSRMILGKTVDDLNLQAVVSPKYFPIFG RGWARLSGEHQGNIQLSRLYVSSSIGDEENPPEFTLKVKDSNRYVIEFGGEEINGKVGEL IEKDGITLKIDEINAKPGAEFTIKYVSKLKAIADLQENLSVADQGKDTGILILSYLGDDP LKIKNIVDSISENYLAQNISRQAAQDEKSLEFLNKQLPMVRSDLDSAEDKLNDFRKRNDS VDLSLEAKSVLDQIVNVDNQLNELTFRESEISQLYTKEHPTYKALMEKRKTLQDERGKLN KRVATMPETQQEILRLSRDVESGRAVYMQLLNRQQELNIAKSSAIGNVRIIDSAVTQHKP VKPKKIIVVLAGLFIGLVISVSLVLVRILLRKGIETPEQLEELGINVYASIPVSESNPKN VIAKRLNKRDDSRPKVLLATENPADLAIEAIRGLRTSLHFAMLEARNNLLMISGASPNAG KTFVSSNLSSVISQTGKKVIFIDADLRKGYTHKLFNIKNTNGLSDYLSGRVALDKIINNL QTEGFDYISRGSVPPNPAELLMHNRLAELLEWANKSYDIVILDTPPILAVADAAIIGNYV GTTLLVARFEENTPKEIDISVKRFQNSGVNIKGCILNGVVKKATNKYGYGYNYYDYSYSD KK
Uniprot No.

Target Background

Protein Families
Etk/wzc family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of tyrosine-protein kinases in the CPS region?

Tyrosine-protein kinases in the capsular polysaccharide (CPS) region play a critical role in regulating bacterial capsule synthesis, which is an essential virulence factor for many pathogenic bacteria. These kinases function within complex phosphoregulatory systems that modulate CPS production in response to environmental conditions. In Gram-positive bacteria such as Streptococcus species, the CPS synthesis is regulated by the CpsBCD phosphoregulatory system, where CpsD functions as a bacterial tyrosine (BY) kinase. The phosphorylation state of CpsD directly influences bacterial capsule production, which in turn affects bacterial survival against host immune defenses and environmental stresses .

Unlike eukaryotic tyrosine kinases, bacterial BY kinases contain characteristic Walker A and B motifs along with a tyrosine-rich tail containing multiple phosphorylation sites. In most Gram-positive bacteria, BY kinases are composed of two separate proteins: CpsC (a membrane protein) and CpsD (the catalytic component), which interact to regulate CPS synthesis .

How do CPS-associated tyrosine-protein kinases differ between Gram-positive and Gram-negative bacteria?

The structural organization and functional mechanisms of CPS-associated tyrosine-protein kinases show notable differences between Gram-positive and Gram-negative bacteria:

FeatureGram-positive BacteriaGram-negative Bacteria
Protein structureSplit into two proteins: CpsC (membrane component) and CpsD (cytoplasmic kinase)Single protein (e.g., Wzc) containing both membrane and kinase domains
Membrane topologyCpsC contains two short cytoplasmic regions at N- and C-terminalsIntegral membrane protein with periplasmic and cytoplasmic domains
Activation mechanismCpsC C-terminal region essential for CpsD auto-kinase activitySelf-activation through the kinase domain
Associated phosphataseCpsBWzb

In Gram-positive bacteria like Streptococcus, the BY kinase function is split between CpsC and CpsD, where CpsC is a membrane protein containing two cytoplasmic regions. The C-terminal sequence of CpsC is essential for activating CpsD auto-kinase activity. In contrast, Gram-negative bacteria like E. coli utilize a single protein (Wzc) that contains both the membrane domain and the kinase domain with its characteristic tyrosine-rich tail .

What are the structural characteristics of bacterial tyrosine kinases in the CPS region?

Bacterial tyrosine kinases in the CPS region possess distinctive structural features that distinguish them from their eukaryotic counterparts:

  • Walker A and B motifs: These conserved nucleotide-binding motifs are essential for ATP binding and hydrolysis during the phosphorylation process.

  • Tyrosine-rich tail: Located at the C-terminus, this region contains multiple tyrosine residues that serve as phosphorylation sites. The phosphorylation status of these tyrosines directly influences kinase activity and CPS production.

  • Membrane association: In Gram-positive bacteria, the kinase (CpsD) interacts with a membrane component (CpsC), which anchors the kinase near the CPS synthesis machinery and regulates its activity.

  • Dimeric structure: Many bacterial tyrosine kinases function as dimers, with the dimerization being important for their catalytic activity and regulation.

  • Phosphorylatable threonine residues: In addition to tyrosine phosphorylation, some CPS-region kinases can be regulated by threonine phosphorylation through serine/threonine kinases like Stk1, establishing cross-talk between different phosphoregulatory systems .

How should I design experiments to study the phosphorylation dynamics of tyrosine-protein kinases in the CPS region?

To effectively study phosphorylation dynamics of tyrosine-protein kinases in the CPS region, a multi-faceted experimental approach is required:

  • Phosphoproteomic analysis: Use mass spectrometry-based phosphoproteomics to identify specific phosphorylation sites. This approach successfully identified threonine phosphorylation sites (Thr4 and Thr7) in CcpS, a protein that links STK signaling to CPS synthesis in Streptococcus suis .

  • Site-directed mutagenesis: Create phosphomimetic (e.g., T→E) and non-phosphorylatable (e.g., T→V) mutants of the kinase to study the functional significance of specific phosphorylation sites. For instance, CcpS variants CcpS-T4ET7E (mimicking phosphorylated Thr residues) and CcpS-T4VT7V (mimicking non-phosphorylated Thr residues) were used to understand the impact of phosphorylation .

  • In vitro kinase assays: Purify recombinant proteins and perform in vitro phosphorylation assays using radiolabeled ATP (γ-32P-ATP) or Phos-tag gel electrophoresis to visualize phosphorylated protein species. The Phos-tag approach was used to demonstrate that both Thr4 and Thr7 of CcpS could be phosphorylated by Stk1 in vitro .

  • Heterologous co-expression systems: Express the kinase of interest along with its regulatory partners in a heterologous host (e.g., E. coli) to study phosphorylation in a controlled environment. This approach validated that Stk1 could phosphorylate CcpS at Thr4 and Thr7 residues .

  • Immunoprecipitation coupled with phospho-specific antibodies: Use this approach to detect phosphorylated kinases in vivo under different conditions. Researchers demonstrated that CcpS phosphorylation was specifically dependent on Stk1 and occurred at Thr4 and Thr7 residues in S. suis .

  • Time-course experiments: Monitor phosphorylation changes over time in response to various stimuli (nutrient availability, stress conditions) to understand dynamic regulation .

What are the optimal conditions for expressing and purifying recombinant tyrosine-protein kinases from the CPS region?

For optimal expression and purification of recombinant tyrosine-protein kinases from the CPS region, consider the following protocol:

  • Expression system selection:

    • For bacterial tyrosine kinases, E. coli BL21(DE3) is commonly used

    • For proteins with complex folding requirements, consider insect cell expression systems

  • Vector optimization:

    • Include a cleavable affinity tag (His6, GST, or MBP)

    • Use a vector with a tightly controlled inducible promoter (T7 or tac)

    • Consider codon optimization for the expression host

  • Expression conditions:

    • Induce at lower temperatures (16-25°C) to enhance solubility

    • Use lower IPTG concentrations (0.1-0.5 mM) for induction

    • Extend expression time (overnight at 16°C)

  • Lysis buffer optimization:

    • Include glycerol (10-15%) to stabilize protein structure

    • Add reducing agents (DTT or β-mercaptoethanol) to prevent disulfide bond formation

    • Include appropriate salts (100-300 mM NaCl) and buffer (20-50 mM Tris-HCl or HEPES, pH 7.5-8.0)

    • Consider adding ATP (1-2 mM) to stabilize the kinase domain

  • Purification strategy:

    • Initial capture: Affinity chromatography (Ni-NTA for His-tagged proteins)

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography to obtain monodisperse protein

    • For kinases that form inclusion bodies, develop a refolding protocol

  • Quality control:

    • Assess purity by SDS-PAGE

    • Verify structural integrity by circular dichroism

    • Confirm enzymatic activity through in vitro kinase assays

When working with bacterial tyrosine kinases like CpsD, it's particularly important to co-express them with their activating partners (e.g., CpsC) to obtain functionally active proteins. Additionally, maintaining an appropriate level of autophosphorylation during purification may be crucial for retaining enzymatic activity .

How can I effectively study the interaction between tyrosine-protein kinases and other components of the CPS synthesis machinery?

To effectively study interactions between tyrosine-protein kinases and other components of the CPS synthesis machinery, employ these methodological approaches:

  • Bacterial two-hybrid (B2H) assays: This approach provides a robust initial screen for protein-protein interactions in a bacterial context. B2H was successfully used to demonstrate that phosphorylation of CcpS is dependent on the presence of Stk1 .

  • Co-immunoprecipitation (Co-IP): For validating interactions in vivo, Co-IP can pull down protein complexes from bacterial lysates. This technique confirmed that CcpS is specifically phosphorylated by Stk1 in S. suis .

  • Surface plasmon resonance (SPR): For quantitative binding kinetics, SPR provides real-time measurement of association and dissociation constants between purified proteins. This can determine how phosphorylation affects binding affinity between kinases and their partners.

  • Isothermal titration calorimetry (ITC): For thermodynamic analysis of protein-protein interactions, ITC measures binding constants, stoichiometry, and thermodynamic parameters.

  • Microscale thermophoresis (MST): This technique measures interactions based on changes in the directed movement of molecules along microscopic temperature gradients, requiring minimal sample amounts.

  • Structural analysis approaches:

    • X-ray crystallography to determine atomic-level structures of protein complexes

    • Cryo-electron microscopy for larger assemblies

    • NMR spectroscopy for dynamic interaction studies

  • FRET-based approaches: For studying interactions in living cells, Förster resonance energy transfer (FRET) can visualize protein proximity in real-time.

  • Crosslinking mass spectrometry: To identify interaction interfaces, chemical crosslinking followed by mass spectrometry analysis can map contact points between proteins.

For specific combinations of proteins, such as CcpS and CpsB, researchers demonstrated that non-phosphorylated CcpS had a higher affinity for CpsB and inhibited its phosphatase activity, which in turn modulated CpsD phosphorylation and ultimately CPS production. This finding illustrates how phosphorylation events can create regulatory circuits within the CPS synthesis machinery .

What are the best approaches for analyzing the effects of tyrosine-protein kinase mutations on CPS production?

To comprehensively analyze the effects of tyrosine-protein kinase mutations on CPS production, implement these methodological approaches:

  • Quantitative CPS measurement:

    • Alcian blue binding assay: Measures total acidic polysaccharide content

    • Anthrone-sulfuric acid method: Quantifies total carbohydrate content

    • ELISA with capsule-specific antibodies: Provides specific quantification

    • Uronic acid assay: Measures uronic acid components of many capsular polysaccharides

  • Microscopy-based capsule visualization:

    • India ink negative staining: Simple method to visualize capsule presence

    • Immunofluorescence microscopy: Allows specific detection with anti-CPS antibodies

    • Transmission electron microscopy: Provides high-resolution imaging of capsule structure

  • Bacterial fitness assessments:

    • Growth curve analysis in various conditions (nutrient limitation, stress)

    • Biofilm formation capacity

    • Resistance to complement-mediated killing

    • Phagocytosis resistance assays

    • Virulence in appropriate infection models

  • Molecular analysis of CPS regulation:

    • RT-qPCR: Measure expression levels of CPS synthesis genes

    • Western blotting with phospho-specific antibodies: Detect phosphorylation states of key proteins

    • Chromatin immunoprecipitation (ChIP): Identify regulatory proteins binding to the cps locus

  • Structural analysis of CPS:

    • Nuclear magnetic resonance (NMR) spectroscopy

    • Mass spectrometry

    • High-performance liquid chromatography (HPLC)

When working with mutations in tyrosine-protein kinases like CpsD, it's particularly important to create both loss-of-function and gain-of-function mutations. For example, replacing phosphorylated tyrosine residues with phenylalanine (Y→F) prevents phosphorylation, while substitution with glutamate (Y→E) can mimic constitutive phosphorylation. These complementary approaches help elucidate the specific role of kinase phosphorylation in CPS production regulation .

How can I establish a reliable phosphorylation assay for tyrosine-protein kinases in the CPS region?

Establishing a reliable phosphorylation assay for tyrosine-protein kinases in the CPS region requires careful consideration of multiple factors:

  • In vitro kinase assay components:

    • Purified recombinant kinase (e.g., CpsD) and substrate proteins

    • Appropriate buffer (typically containing 20-50 mM Tris-HCl or HEPES pH 7.5, 5-10 mM MgCl₂, 1-5 mM DTT)

    • ATP (50-200 μM) with or without radioactive label (γ-³²P-ATP)

    • For bacterial tyrosine kinases, inclusion of activating partners (e.g., CpsC for CpsD)

  • Detection methods:

    • Radioactive assay: Using γ-³²P-ATP followed by SDS-PAGE and autoradiography

    • Phos-tag SDS-PAGE: Incorporates Phos-tag molecules that specifically bind phosphorylated proteins, causing mobility shift

    • Western blotting: Using phospho-specific antibodies or general phosphotyrosine antibodies

    • ELISA-based methods: For high-throughput analysis

    • Mass spectrometry: For precise identification of phosphorylation sites

  • Assay validation controls:

    • Kinase-dead mutants (e.g., K→R mutation in the ATP-binding site)

    • Non-phosphorylatable substrate mutants (Y→F mutations)

    • Known kinase inhibitors as negative controls

  • Phosphorylation kinetics analysis:

    • Time-course experiments (0-60 minutes)

    • ATP concentration series (Km determination)

    • Substrate concentration series (Vmax determination)

  • Environmental conditions optimization:

    • Temperature optimization (typically 25-37°C)

    • pH optimization (typically pH 7.0-8.0)

    • Divalent cation requirements (Mg²⁺, Mn²⁺)

For the specific case of bacterial tyrosine kinases like CpsD, it's critical to account for their unique regulatory mechanisms. Research has shown that CpsD activity depends on interaction with CpsC, and its phosphorylation state can be modulated by other regulatory proteins like CcpS, which itself is regulated by serine/threonine kinase Stk1 .

What techniques are most effective for monitoring changes in CPS expression in response to tyrosine-protein kinase activity?

For effective monitoring of changes in CPS expression in response to tyrosine-protein kinase activity, implement these methodological approaches:

  • Transcriptional analysis methods:

    • RT-qPCR: Quantifies expression levels of cps locus genes with high sensitivity

    • RNA-Seq: Provides comprehensive transcriptome-wide analysis to identify both direct and indirect effects of kinase activity on gene expression

    • Reporter gene assays: Using promoter fusions with luciferase or fluorescent proteins to monitor cps operon expression in real-time

  • Protein-level analysis:

    • Western blotting: Detects phosphorylation states of key regulatory proteins (e.g., CpsD, CpsB)

    • Immunoprecipitation: Isolates protein complexes involved in CPS regulation

    • Phos-tag gel electrophoresis: Differentiates between phosphorylated and non-phosphorylated forms of regulatory proteins

  • CPS quantification techniques:

    • Colorimetric assays: Anthrone-sulfuric acid method for total carbohydrate content

    • HPLC analysis: For detailed compositional analysis of purified CPS

    • Enzyme-linked immunosorbent assay (ELISA): Using anti-CPS antibodies for specific quantification

    • Flow cytometry: Using fluorescently labeled antibodies to measure CPS on individual bacterial cells

  • Microscopic analysis:

    • Fluorescence microscopy: Using fluorescently labeled lectins or antibodies

    • Scanning electron microscopy (SEM): For surface morphology changes

    • Transmission electron microscopy (TEM): For detailed capsule structure visualization

  • Functional assays:

    • Biofilm formation: Measures the impact of CPS changes on bacterial aggregation

    • Serum resistance assays: Evaluates how CPS changes affect complement resistance

    • Phagocytosis assays: Determines the effect on immune cell interactions

When designing experiments to monitor CPS expression in response to tyrosine-protein kinase activity, it's important to create a comprehensive experimental matrix that includes different growth phases and environmental conditions. Research has shown that CPS regulation through phosphorylation is dynamic and responds to environmental cues like nutrient availability. For example, in S. suis, the phosphorylation level of CcpS (which influences CPS production through the CpsBCD system) increased in nutrient-rich media and decreased during starvation .

How should I interpret contradictory results between in vitro and in vivo studies of tyrosine-protein kinase phosphorylation in the CPS region?

When faced with contradictory results between in vitro and in vivo studies of tyrosine-protein kinase phosphorylation in the CPS region, apply this systematic approach to interpretation:

  • Identify potential sources of discrepancy:

    • Protein context differences: In vitro studies use purified proteins that may lack crucial binding partners or regulatory elements present in vivo

    • Post-translational modification states: Proteins expressed in heterologous systems may lack proper modifications

    • Structural considerations: Protein folding and conformation may differ between in vitro and in vivo conditions

    • Concentration effects: Protein concentrations in in vitro assays often exceed physiological levels

  • Validation strategies:

    • Complementary methodologies: Use multiple techniques to address the same question

    • Reconstitution experiments: Gradually increase complexity of in vitro systems by adding potential regulatory factors

    • Domain-focused analysis: Isolate specific domains to determine if contradictions arise from domain interactions

    • Mutation analysis: Create targeted mutations to test specific hypotheses arising from contradictory results

  • Case study approach from literature:
    The research on CcpS phosphorylation by Stk1 demonstrates a comprehensive validation approach:

    • Initial phosphoproteomic analysis identified phosphorylation sites

    • Bacterial two-hybrid assays confirmed protein interactions

    • In vitro phosphorylation with purified recombinant proteins validated direct interactions

    • Heterologous co-expression verified specific phosphorylation sites

    • Immunoprecipitation from native bacteria confirmed in vivo relevance

    • Phosphatase assays determined specificity of dephosphorylation

  • Data integration framework:

Result TypeInterpretation WeightValidation Requirement
In vitro biochemicalMechanistic insightsPhysiological relevance confirmation
Heterologous expressionSpecificity confirmationNative host verification
In vivo native hostPhysiological relevanceMechanistic explanation
Structural dataMolecular mechanismFunctional validation

When interpreting contradictory results, consider that the true biological system may involve conditional regulation. For example, the study of CcpS phosphorylation revealed that its phosphorylation state changes dynamically in response to environmental conditions like nutrient availability, suggesting context-dependent regulation mechanisms .

What statistical approaches are most appropriate for analyzing phosphorylation-dependent changes in CPS production?

For robust statistical analysis of phosphorylation-dependent changes in CPS production, implement these methodological approaches:

  • Experimental design considerations:

    • Include biological replicates (minimum n=3) to account for natural biological variation

    • Include technical replicates to control for measurement variation

    • Design factorial experiments to assess interactions between variables (e.g., phosphorylation state and environmental conditions)

    • Include time-course measurements to capture dynamic changes

  • Statistical methods for hypothesis testing:

    • Two-group comparisons: Student's t-test (parametric) or Mann-Whitney U test (non-parametric)

    • Multi-group comparisons: One-way ANOVA with appropriate post-hoc tests (Tukey, Bonferroni) for parametric data or Kruskal-Wallis with Dunn's post-hoc test for non-parametric data

    • Two-factor analysis: Two-way ANOVA to assess interactions between factors (e.g., mutation status and growth phase)

    • Repeated measures designs: Repeated measures ANOVA for time-course experiments

  • Correlation analysis:

    • Pearson correlation (parametric) or Spearman rank correlation (non-parametric) to assess relationships between phosphorylation levels and CPS production

    • Multiple regression to model contributions of multiple phosphorylation sites

  • Advanced statistical approaches:

    • Principal component analysis (PCA): For dimensionality reduction in multi-parameter experiments

    • Cluster analysis: To identify patterns in complex datasets

    • Mixed-effects models: For nested experimental designs with multiple sources of variation

  • Visualization and reporting:

    • Boxplots showing distribution of data points

    • Scatter plots with regression lines for correlation analysis

    • Bar graphs with error bars representing standard deviation or standard error

    • Always report exact p-values and effect sizes, not just significance levels

When analyzing phosphorylation-dependent changes in CPS production, it's particularly important to account for growth phase effects, as research has shown significant differences in phosphorylation patterns between logarithmic and stationary phases. For example, studies demonstrated that CcpS phosphorylation levels increased significantly during logarithmic growth phase, correlating with changes in CPS production .

How can I differentiate between direct and indirect effects of tyrosine-protein kinase activity on CPS synthesis?

To differentiate between direct and indirect effects of tyrosine-protein kinase activity on CPS synthesis, implement these methodological approaches:

  • Temporal analysis strategies:

    • Pulse-chase experiments: Use rapid induction or inhibition of kinase activity followed by time-course analysis of phosphorylation events and CPS production

    • Synchronization techniques: Align bacterial populations to specific cell cycle stages to track sequential events

    • Time-resolved phosphoproteomics: Identify the order of phosphorylation events following kinase activation

  • Molecular interaction mapping:

    • Protein-protein interaction networks: Construct interaction maps using yeast two-hybrid, co-immunoprecipitation, or crosslinking mass spectrometry

    • Phosphorylation site mapping: Identify the complete set of substrates using phosphoproteomics

    • Epistasis analysis: Determine genetic hierarchies by creating double mutants

  • Biochemical validation approaches:

    • In vitro reconstitution: Rebuild minimal systems with purified components to test direct effects

    • Substrate specificity analysis: Determine kinetic parameters for different substrates

    • Phosphotransfer profiling: Track the flow of phosphate groups through regulatory cascades

  • Structural biology approaches:

    • Co-crystal structures: Determine molecular interfaces between kinases and substrates

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identify regions involved in protein interactions

    • FRET-based biosensors: Monitor protein interactions in real-time in living cells

  • Computational methods:

    • Kinase-substrate prediction algorithms: Identify potential direct targets based on consensus motifs

    • Network analysis: Model regulatory networks to predict direct vs. indirect effects

    • Molecular dynamics simulations: Predict structural changes upon phosphorylation

Research on tyrosine-protein kinases in the CPS region has revealed complex regulatory networks. For example, studies identified that CcpS serves as an intermediary between the Stk1/Stp1 serine/threonine phosphorylation system and the CpsBCD tyrosine phosphorylation system. Specifically, non-phosphorylated CcpS binds to and inhibits CpsB phosphatase activity, which in turn affects CpsD phosphorylation status and ultimately CPS production. This exemplifies how a kinase (Stk1) can influence CPS synthesis indirectly through a cascade of protein interactions and phosphorylation events .

What are the most promising approaches for targeting tyrosine-protein kinases in the CPS region for antimicrobial development?

The following approaches represent the most promising strategies for targeting tyrosine-protein kinases in the CPS region for antimicrobial development:

  • Structure-based inhibitor design:

    • Exploit structural differences between bacterial tyrosine kinases and human kinases

    • Focus on the unique ATP-binding pocket architecture of bacterial BY kinases

    • Design allosteric inhibitors targeting regulatory interactions specific to bacterial systems

    • Develop covalent inhibitors targeting conserved cysteine residues in bacterial kinases

  • Multi-target strategies:

    • Design dual inhibitors targeting both tyrosine kinases (e.g., CpsD) and serine/threonine kinases (e.g., Stk1)

    • Target kinase-substrate interfaces rather than catalytic sites

    • Develop compounds disrupting protein-protein interactions in the CpsBCD regulatory complex

  • Capsule biosynthesis attenuation:

    • Create inhibitors that modulate rather than completely block CPS production

    • Target regulatory phosphorylation sites to attenuate virulence without strong selection pressure

    • Develop compounds that sensitize encapsulated bacteria to host immune defenses

  • Delivery system innovations:

    • Design nanoparticle-based delivery systems to penetrate bacterial capsules

    • Exploit bacteriophage-derived proteins to deliver inhibitors through capsular barriers

    • Develop prodrugs activated by bacterial enzymes for targeted delivery

  • Screening approaches:

    • Implement phenotypic screens measuring capsule reduction rather than growth inhibition

    • Develop high-throughput phosphorylation assays using fluorescence-based readouts

    • Create bacterial reporter strains with fluorescent outputs linked to CPS regulatory systems

This approach leverages our understanding of the complex regulatory networks involving tyrosine-protein kinases in CPS biosynthesis. Research has shown that these kinases participate in sophisticated phosphoregulatory systems that influence bacterial virulence through capsule production. For example, the discovery that CcpS links Stk1 signaling to the CpsBCD system presents a potential target for disrupting this regulatory network and attenuating bacterial virulence without directly killing bacteria, which might reduce selection pressure for resistance .

How might environmental sensing mechanisms connect to tyrosine-protein kinase activity in the CPS region?

Environmental sensing mechanisms likely connect to tyrosine-protein kinase activity in the CPS region through multi-layered signaling networks:

  • Nutrient availability sensing:
    Research has demonstrated that CcpS phosphorylation levels rapidly increase in nutrient-rich media and significantly decrease during starvation. This pattern matches Stk1 kinase activity, suggesting that nutrient sensing systems directly influence Stk1 activity, which then regulates CcpS phosphorylation and subsequently affects the CpsBCD system controlling CPS production .

  • Stress response integration:
    Bacterial eSTKs like Stk1 often function as stress response regulators, detecting cell envelope stress, oxidative stress, and antimicrobial compounds. The phosphorylation cascade from Stk1 through CcpS to the CpsBCD system likely allows bacteria to adjust capsule production in response to diverse environmental threats.

  • Host-pathogen interaction sensing:
    The PASTA domains in Stk1's extracellular portion may detect specific host-derived molecules during infection, triggering kinase activity changes that propagate through the CcpS-CpsBCD signaling axis to modulate capsule production during different infection stages.

  • Cell cycle and growth phase coordination:
    Studies have shown that CcpS phosphorylation increases significantly during logarithmic growth phase compared to stationary phase, suggesting coordination between cell division processes and capsule biosynthesis regulation .

  • Proposed integrated sensing model:

Environmental ConditionSensor SystemSignaling PathwayEffect on CPS
Nutrient availabilityMetabolic sensorsStk1→CcpS-P→CpsB activation→CpsD-P↓Increased CPS in nutrient-rich conditions
Cell envelope stressPASTA domainsStk1→CcpS-P→altered CpsBCD activityCPS adjustment for protection
Oxygen/redox changesRedox-sensitive residuesAltered Stk1/Stp1 balance→CcpS phosphorylation stateCPS adaptation to oxidative environments
Host immune factorsSurface receptorsSignal transduction→Stk1 activation→CPS regulationImmune evasion optimization

The identification of CcpS as a link between the Stk1/Stp1 and CpsBCD systems represents a significant advancement in understanding how bacteria coordinate environmental sensing with capsule production. This integrated signaling network allows bacteria to precisely adjust their capsular polysaccharide production in response to changing environments, which is crucial for bacterial survival during infection and environmental stress .

What role might intrinsically disordered regions play in the function of tyrosine-protein kinases and their regulators in the CPS region?

Intrinsically disordered regions (IDRs) likely play several crucial roles in the function of tyrosine-protein kinases and their regulators in the CPS region, as evidenced by recent discoveries:

  • Phosphorylation-dependent conformational switching:
    The crystal structure of CcpS from S. suis revealed an intrinsically disordered region at its N-terminus containing two threonine residues (Thr4 and Thr7) that are phosphorylated by Stk1. This suggests that IDRs serve as flexible phosphorylation platforms that can undergo conformational changes upon modification, thereby modulating protein function. Research demonstrated that CcpS function is dependent on these IDRs, which can be tuned by phosphorylation .

  • Protein-protein interaction regulation:
    IDRs often mediate dynamic and regulated protein-protein interactions. In the case of CcpS, the phosphorylation state of its N-terminal IDR appears to regulate its interaction with CpsB. Non-phosphorylated CcpS showed higher affinity for CpsB and inhibited its phosphatase activity, while phosphorylation likely altered this interaction. This mechanism creates a phosphorylation-dependent switch in the regulatory network .

  • Structural consequences of IDR phosphorylation:

FeatureNon-phosphorylated IDRPhosphorylated IDR
Binding affinity to CpsBHigherLower
Effect on CpsB activityInhibitoryReduced inhibition
Downstream impact on CpsDIncreased phosphorylationDecreased phosphorylation
Ultimate effect on CPSAltered productionBaseline production
  • Evolutionary advantages of IDRs in regulatory networks:

    • Provide conformational plasticity allowing one protein to interact with multiple partners

    • Enable rapid and reversible regulation through post-translational modifications

    • Allow for complex regulation through combinatorial modification patterns

    • Create functional diversity with minimal genetic changes

  • Future research opportunities:

    • Structural characterization of IDRs in different phosphorylation states

    • Identification of additional binding partners interacting with phosphorylated vs. non-phosphorylated IDRs

    • Investigation of how IDR mutations affect bacterial pathogenesis

    • Exploration of IDRs as potential drug targets

The discovery that CcpS contains functionally important IDRs that can be modified by phosphorylation suggests that such regions may be widespread among regulatory proteins in bacterial phosphosignaling networks. The phosphorylation-dependent conformational changes in these regions likely create molecular switches that allow bacteria to rapidly adjust capsule production in response to environmental conditions, representing a sophisticated regulatory mechanism evolved to enhance bacterial survival and virulence .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.