Recombinant Putative UDP-glucuronosyltransferase ugt-55 (ugt-55)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ugt-55; ugt11; T04H1.7; Putative UDP-glucuronosyltransferase ugt-55; UDPGT 55
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-512
Protein Length
Full Length of Mature Protein
Species
Caenorhabditis elegans
Target Names
ugt-55
Target Protein Sequence
LRILVYSPRMIPSHVAFVANIANLLGQRGHNVVVVDNVLRSDISNKLDLKVIEKVVKVET SANVAKLLADQSIPINFWSMRNEPEEQKKVMKQLGIIFLEQCKYLVSKEETVFNELKHLE FDFGIHEVFDICGIGIFEKLGIRKSVILSSTGMRDIVNEALGISSQLQDASILSDYGNSI PFYGIRRNLKFHSAWRNFFEVQSKTLEPLFETTSSFENLLRFSNLMFLNTHELADAHRPW SRRVHEIGGISFKFPMPLKNEYINLFNKYNSIILVSFGTTTPSFLMPEKYKNTLINTFQR FPDFLFIWKYEKDDEFTQKNKKGNVVFKKFLPQVDLLESRKIKLFITHGGQNSLLETFHS NTRTLITPLFGDQHRNAQIALENGLSHVLLKDQLANEELVYAAIKQGTESNKKLDDNLLK LSSNLKNAKQTSENLFLDTVESTYTDNLSPLNFEFYPKLYSSDQILLYLDSIAMFTLTLL TMILIRKFLL
Uniprot No.

Target Background

Database Links

STRING: 6239.T04H1.7

UniGene: Cel.39248

Protein Families
UDP-glycosyltransferase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is UDP-glucuronosyltransferase ugt-55 and what organism is it found in?

UDP-glucuronosyltransferase ugt-55 (also known as ugt-55, ugt11, or T04H1.7) is a putative enzyme belonging to the UDP-glucuronosyltransferase family found in Caenorhabditis elegans, a free-living transparent nematode commonly used as a model organism in genetic research. This enzyme is one of over 70 UGT genes identified in C. elegans, which contrasts with the 22 UGT genes found in humans . The enzyme is classified under EC 2.4.1.17 and functions as a membrane-bound protein, likely associated with the endoplasmic reticulum . The full mature protein spans amino acids 23-512 and is involved in phase II detoxification processes, where it catalyzes the addition of sugar moieties to various substrates to increase their water solubility and facilitate excretion .

What is the function of ugt-55 in C. elegans?

Based on homology with other UDP-glucuronosyltransferases, ugt-55 in C. elegans is believed to function in detoxification pathways by catalyzing the addition of sugar molecules to xenobiotics or endogenous compounds. UGT enzymes in C. elegans, including potentially ugt-55, are involved in adding glucose moieties during phase II xenobiotic detoxification . This process helps convert lipophilic substances into more water-soluble compounds that can be more easily excreted.

While the specific substrates of ugt-55 have not been fully characterized in the available literature, studies on other UGT enzymes in C. elegans show they can modify toxins such as 1-hydroxyphenazine (1-HP) by adding glucose or N-acetylglucosamine (GlcNAc) molecules . The expansion of the UGT family in C. elegans (over 70 members compared to 22 in humans) suggests specialized roles for different UGT enzymes in detoxification processes, with ugt-55 likely having evolved specific substrate preferences that help C. elegans respond to environmental toxins .

What expression systems are optimal for producing functional recombinant ugt-55?

Several expression systems can be used for producing recombinant ugt-55, each with distinct advantages:

Expression SystemAdvantagesLimitationsApplications
E. coliHigh yield, rapid growth, simple protocolsLimited post-translational modificationsStructural studies, high-throughput screens
YeastEukaryotic protein processing, moderate yieldGlycosylation patterns differ from higher eukaryotesFunctional studies requiring some PTMs
Baculovirus/Insect cellsMore authentic eukaryotic processingMore complex, lower yield than bacterial systemsFunctional studies requiring proper folding
Mammalian cellsMost authentic processing and modificationsLowest yield, highest costStudies requiring native-like activity

How can recombinant ugt-55 be purified for functional studies?

Purification of recombinant ugt-55 typically involves several key steps:

  • Affinity chromatography: Most recombinant ugt-55 proteins are expressed with histidine (His) tags, allowing purification using immobilized metal affinity chromatography (IMAC) . The His-tagged protein binds to nickel or cobalt resins and can be eluted with imidazole.

  • Quality assessment: SDS-PAGE is commonly used to assess protein purity, with commercial preparations typically achieving ≥85-90% purity . Western blotting with anti-His antibodies or specific anti-ugt-55 antibodies can confirm identity.

  • Buffer optimization: For functional studies, the protein should be exchanged into an appropriate buffer. Reported storage buffers include Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

  • Stabilization considerations: For long-term storage, 50% glycerol is typically added and the protein is aliquoted to avoid repeated freeze-thaw cycles . Lyophilized preparations can be reconstituted in deionized sterile water to 0.1-1.0 mg/mL concentration .

As a membrane-bound enzyme, special considerations may be necessary to maintain ugt-55 activity. This could include the addition of detergents (e.g., mild non-ionic detergents like Triton X-100 or digitonin) or incorporation into lipid nanodiscs or liposomes to provide a native-like membrane environment. These approaches may be particularly important when studying catalytic activity rather than just structural properties.

What experimental methods are effective for studying ugt-55 activity?

Several experimental methods can be employed to study ugt-55 activity:

  • UDP-Glo™ Glycosyltransferase Assay: This bioluminescent assay detects UDP release during glycosylation reactions, providing high sensitivity (0.1-0.5 pmol UDP) and a homogeneous format suitable for high-throughput screening . The assay works with any UDP-sugar utilizing glycosyltransferase and various substrate combinations.

  • Radioactive substrate assays: Using 14C-labeled UDP-sugars, the glycosylated products can be separated by thin-layer chromatography and quantified by autoradiography or phosphoimaging . This method offers high sensitivity but requires radioactive materials handling.

  • LC-MS/MS detection of glycosylated products: Liquid chromatography-tandem mass spectrometry enables detection of specific glycosylated products with high specificity and sensitivity . The method described in search result uses selected reaction monitoring (SRM) transitions for detecting glucuronide conjugates.

  • Cell-based assays: Expressing ugt-55 in cellular systems allows for assessment of activity in a more physiological context. Substrate conversion can be measured by analyzing cell extracts or media for glycosylated products.

  • In vivo studies with C. elegans: Comparing wild-type and ugt-55 knockout worms in their ability to metabolize potential substrates provides insights into physiological function .

For optimal activity determination, key experimental parameters to consider include:

  • pH optimization (UGTs can have distinct pH optima that affect substrate specificity)

  • Buffer composition (presence of divalent cations, particularly Mg2+)

  • Detergent selection (for solubilization without activity loss)

  • UDP-sugar co-substrate concentration

  • Potential activators or inhibitors

How does ugt-55 contribute to xenobiotic metabolism in C. elegans?

While the specific role of ugt-55 has not been fully characterized, UGT enzymes in C. elegans play crucial roles in xenobiotic metabolism through phase II detoxification:

  • Sugar conjugation: UGTs in C. elegans catalyze the addition of sugar moieties (glucose or N-acetylglucosamine) to xenobiotics, increasing their water solubility and facilitating excretion . This differs from mammalian UGTs, which primarily use glucuronic acid.

  • Multiple glycosylation stages: Some UGTs in C. elegans can add sequential sugar molecules to toxins. For example, 1-hydroxyphenazine (1-HP) from Pseudomonas aeruginosa can be modified with one, two, or three glucose molecules in wild-type worms .

  • Differential roles in detoxification pathways: Research shows that specific UGTs have distinct roles in detoxification. For instance, ugt-23 knockout mutants produce reduced amounts of trisaccharide sugars attached to 1-HP, while ugt-49 knockout mutants show reduced production of all 1-HP derivatives .

  • Broad substrate specificity: The large UGT family in C. elegans (>70 members) suggests evolved specificity for diverse xenobiotics encountered in the worm's soil environment. Research suggests multiple UGT genes are responsible for glycosylation of small-molecule toxins .

  • Novel detoxification mechanisms: Recent research has identified the addition of N-acetylglucosamine (GlcNAc) in C. elegans detoxification pathways, a mechanism not previously widely reported .

As part of this extensive UGT family, ugt-55 likely participates in a specific aspect of this xenobiotic detoxification network, potentially with unique substrate preferences and expression patterns.

What challenges arise in studying ugt-55 enzymatic function in vitro?

Studying ugt-55 enzymatic function in vitro presents several technical challenges:

  • Membrane protein solubilization: As a membrane-bound enzyme typically associated with the endoplasmic reticulum , ugt-55 requires appropriate solubilization strategies. Detergent selection is critical - too harsh detergents may denature the protein, while insufficient solubilization limits activity.

  • Post-translational modifications: UGT enzymes can be regulated by post-translational modifications, particularly phosphorylation . Research on mammalian UGTs shows that PKC-mediated phosphorylation significantly affects activity and substrate specificity. Expression systems may not reproduce these modifications correctly.

  • Co-factor requirements: Complete UGT activity requires the appropriate UDP-sugar co-substrate. For C. elegans UGTs, this may include UDP-glucose or UDP-N-acetylglucosamine , which must be present at optimal concentrations.

  • Identifying physiological substrates: With the broad substrate specificity typical of UGT enzymes, identifying the physiologically relevant substrates for ugt-55 requires extensive screening efforts.

  • Assay sensitivity and specificity: Detection of glycosylation products may require sophisticated analytical methods with sufficient sensitivity to detect low-abundance products.

  • Expression and purification yields: Obtaining sufficient quantities of properly folded, active enzyme can be challenging with membrane proteins. The search results indicate that commercial preparations typically achieve ≥85-90% purity by SDS-PAGE .

  • Stability concerns: Like many membrane proteins, UGTs may have limited stability once extracted from their native membrane environment. Storage conditions (temperature, buffer composition, presence of glycerol) significantly impact retention of activity .

How can ugt-55 knockout models be used to understand its biological role?

C. elegans knockout models provide powerful tools for understanding the biological role of ugt-55. Based on approaches described for other UGT genes, the following methodologies would be valuable:

  • Toxin sensitivity profiling: Exposing ugt-55 knockout worms to various toxins and comparing survival rates to wild-type worms reveals potential substrates. Research on other UGT knockouts showed increased sensitivity to specific toxins - for example, ugt-23 and ugt-49 knockout mutants demonstrated greater sensitivity to 1-hydroxyphenazine (1-HP) than reference strains .

  • Metabolomics analysis: Comparing the metabolome of wild-type and ugt-55 knockout worms using LC-MS or similar techniques can reveal which compounds accumulate in the absence of ugt-55 activity. This untargeted approach can identify unexpected substrates.

  • Xenobiotic metabolism tracking: Administering potential substrates to wild-type and knockout worms and comparing the glycosylated products formed provides direct evidence of ugt-55 activity. Research demonstrated that ugt-23 knockouts showed reduced trisaccharide formation, while ugt-49 knockouts showed reduced production of all 1-HP derivatives .

  • Developmental and behavioral phenotyping: Observing changes in development, lifespan, reproduction, or behavior in ugt-55 knockout worms under various conditions can reveal physiological roles beyond xenobiotic metabolism.

  • Tissue-specific rescue: Re-expressing ugt-55 in specific tissues of knockout worms can determine where its function is most critical, providing insights into its biological context.

  • Comparative analysis with other UGT knockouts: Phenotypic comparison between different UGT knockout strains can reveal functional redundancy or specialization within this large enzyme family .

  • Stress response assessments: Testing how ugt-55 knockout affects tolerance to various stressors (oxidative, heat, pathogen exposure) can reveal broader physiological roles.

How does phosphorylation regulate UGT activity and might this apply to ugt-55?

While phosphorylation of ugt-55 specifically has not been characterized in the available literature, research on mammalian UGTs provides valuable insights that may apply to ugt-55:

Studies on mammalian UGT1A7 and UGT1A10 revealed that phosphorylation significantly regulates activity and substrate specificity . Key findings include:

  • PKC-mediated regulation: UGT isozymes are phosphorylated by Protein Kinase C (PKC), particularly PKCε. Inhibition of PKC with curcumin, calphostin-C, or PKC-specific inhibitors decreased UGT phosphorylation and activity .

  • Specific phosphorylation sites: Three PKC phosphorylation sites were identified in mammalian UGTs: T73, T202, and S432. Mutation of these sites (particularly T73A/G and T202A/G) resulted in complete loss of activity .

  • Altered substrate specificity: Most significantly, phosphorylation status dramatically affected substrate selectivity. The S432G mutation in UGT1A7 caused "a major shift of its pH-8.5 optimum to 6.4 with new substrate selections, including 17β-estradiol" .

  • Bidirectional regulation: PKCε overexpression enhanced activity of wild-type UGT1A7 but not its S432 mutant, while PKC inhibition increased 17β-estradiol catalysis 5-11 fold .

For ugt-55 research, these findings suggest:

  • Potential phosphorylation sites could be identified through sequence alignment with mammalian UGTs

  • Site-directed mutagenesis of these predicted sites could determine their functional significance

  • Experiments with PKC activators/inhibitors could reveal regulation of ugt-55 activity

  • Phosphorylation status could be monitored using phosphoprotein-specific staining or mass spectrometry

  • Changes in substrate specificity under different phosphorylation conditions could be assessed

How can metabolomics approaches identify physiological substrates of ugt-55?

Metabolomics offers powerful strategies to identify physiological substrates of ugt-55:

  • Comparative untargeted metabolomics: Analyzing metabolite profiles of wild-type versus ugt-55 knockout C. elegans using high-resolution LC-MS/MS. Metabolites that accumulate in knockouts represent potential substrates, while those that decrease may be products of ugt-55 activity.

  • Substrate exposure experiments: Exposing wild-type and ugt-55 knockout worms to candidate substrates and analyzing differences in metabolite profiles. Research on other UGT knockouts demonstrated that different mutants produced altered amounts of specific glycosylated derivatives .

  • Stable isotope tracing: Using isotopically labeled potential substrates to track their metabolic fate in wild-type versus knockout worms, directly identifying metabolites produced by ugt-55 activity.

  • Multivariate statistical analysis: Applying principal component analysis (PCA) or partial least squares discriminant analysis (PLS-DA) to identify patterns in metabolite changes associated with ugt-55 knockout.

  • In vitro validation: Following identification of candidate substrates via metabolomics, confirming direct enzymatic activity using purified recombinant ugt-55 and sensitive analytical methods .

  • Structural characterization of modified metabolites: Using tandem mass spectrometry and NMR to identify the exact structure of glycosylated products, including the type and position of sugar conjugation.

  • Integration with transcriptomics: Correlating changes in the metabolome with gene expression patterns to identify metabolic pathways involving ugt-55 and potential co-regulated processes.

Implementation considerations include:

  • Sample preparation optimization to capture both polar and non-polar metabolites

  • Use of multiple extraction methods to ensure comprehensive metabolite coverage

  • Application of diverse analytical platforms (HILIC, reverse phase LC-MS, GC-MS)

  • Development of targeted MRM methods for confirmed substrates to improve sensitivity

What is the evolutionary relationship between ugt-55 and UGT enzymes in other species?

The evolutionary relationship between ugt-55 and UGTs in other species reveals important insights into functional conservation and specialization:

For ugt-55 specifically, comprehensive phylogenetic analysis comparing it with UGTs from diverse species would be necessary to establish its precise evolutionary relationships and identify potential functional orthologs in other organisms. Such analysis could provide insights into substrate specificity evolution and possible translational relevance to human health or parasitic nematode control.

How can the structure-function relationship of ugt-55 be investigated?

Investigating the structure-function relationship of ugt-55 requires a multi-faceted approach:

  • Homology modeling: In the absence of an experimental structure, computational models based on known UGT structures can predict ugt-55's three-dimensional conformation. This approach can identify potential substrate binding sites and catalytic residues.

  • Site-directed mutagenesis: Based on structural predictions or alignment with well-characterized UGTs, key residues can be mutated to determine their roles in substrate binding, catalysis, or regulation. Research on mammalian UGTs identified specific residues (T73, T202, S432) that significantly impact function when mutated .

  • Domain swapping experiments: Creating chimeric proteins by exchanging domains between ugt-55 and other UGTs can help determine which regions confer specific substrate preferences or catalytic properties.

  • Substrate docking simulations: Computational prediction of how potential substrates interact with the ugt-55 binding pocket can guide substrate specificity studies and identify key interaction residues.

  • Protein modification analysis: Investigating how post-translational modifications (particularly phosphorylation) affect ugt-55 structure and function. Research on mammalian UGTs demonstrated that phosphorylation dramatically alters substrate specificity .

  • Expression and purification of individual domains: Expressing the N-terminal (substrate binding) or C-terminal (UDP-sugar binding) domains separately can facilitate structural studies and binding assays.

  • pH and temperature stability profiling: Determining how environmental conditions affect ugt-55 stability and activity can provide insights into structural flexibility and optimal functional conditions.

  • Detergent and lipid environment optimization: As a membrane-bound enzyme, ugt-55's activity is likely influenced by its membrane environment. Testing various detergents and lipid compositions can reveal structural requirements for optimal function.

These complementary approaches would provide comprehensive insights into how ugt-55's structure determines its substrate specificity, catalytic mechanism, and regulatory properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.