Recombinant Putative UDP-glucuronosyltransferase ugt-60 (ugt-60)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ugt-60; C07A9.6; Putative UDP-glucuronosyltransferase ugt-60; UDPGT 60
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
16-507
Protein Length
Full Length of Mature Protein
Species
Caenorhabditis elegans
Target Names
ugt-60
Target Protein Sequence
LRILQIVPGFTNSHVLFNYRLAETLRFLGHDVKMWTQMEMAMLDTGNNKLPEGVSEYRIP IHFTDTLKTEGLKVFQSMMFESGDAHDLWWTGQEFKDMRVEACEQMLRHDESVYEDFRKD GFDVAIAHFHDLCPLAIAKKMNVKRVIWITHGTSIYEFSAVQLGLRTIPSTIPHPLSSAG FSQLFLDRVQNTLWHLSLLDFVNLPQNLLVDENLFYREFVGADQDDLWDLAKTTVPSLLI NGDRMLDFPRPLPIHIAFSGELGVSKGKKLVMEKWLEDIIEKPSDGLIVFSLGTVSNTTN MPAQMINSFLGAFGKLKTYTILWRMEKSVAGAEKYENLHLVKWLPQKDIMRHPKMKLMIA HGGYNSFLEAAQAGIPAVLMPLFADQKINAKRAQRYGMATVLDKLDLTINNVYGAIKEAL KPEYSTNAKKLSAMLSDQVARKPYSALRYSLKLATSPKPSLFTLKSQHLSFLEFHNLDIF SIVLLTAFIVCF
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_C07A9.6

STRING: 6239.C07A9.6

UniGene: Cel.10865

Protein Families
UDP-glycosyltransferase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is UDP-glucuronosyltransferase ugt-60 and what organism does it originate from?

UDP-glucuronosyltransferase ugt-60 (ugt-60) is a putative enzyme involved in phase II metabolism, specifically in the glucuronidation process. The protein originates from Caenorhabditis elegans, a nematode widely used as a model organism in biological research . The full-length mature protein spans amino acid positions 16-507 and contains specific domains characteristic of the UDP-glucuronosyltransferase family. When studying this protein, researchers should consider its evolutionary relationship with human UGTs, as C. elegans serves as an important model for understanding conserved metabolic pathways across species.

How should recombinant ugt-60 protein be stored and handled for optimal stability?

For optimal stability of the recombinant ugt-60 protein, follow these methodological guidelines:

  • Store the lyophilized powder at -20°C/-80°C upon receipt.

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles.

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 50% for long-term storage at -20°C/-80°C.

  • Working aliquots can be stored at 4°C for up to one week.

  • The reconstitution buffer should be Tris/PBS-based with 6% Trehalose at pH 8.0 .

Understanding the physicochemical properties of the protein is essential for ensuring its stability. Researchers should verify protein integrity after storage through techniques such as SDS-PAGE or activity assays before proceeding with experiments.

What experimental approaches are recommended for assessing ugt-60 glucuronidation activity?

To effectively assess ugt-60 glucuronidation activity, researchers should implement a multi-faceted methodological approach:

  • Fluorescence-based assays: Utilize coumarin derivatives like 7-hydroxycoumarin as fluorescent substrates. The glucuronidation reaction converts these compounds to non-fluorescent glucuronides, allowing for real-time monitoring of enzyme activity .

  • Incubation conditions optimization:

    • Buffer: 100 mM Tris-HCl (pH 7.4) containing 5 mM MgCl₂

    • Cofactor: 0.5 mM UDPGA (UDP-glucuronic acid)

    • Substrate concentration: 0-15 μM of test aglycone substrate

    • Temperature: 37°C

    • Time: Linear range determination through time-course experiments

  • Spectrofluorometric analysis: Monitor fluorescence decrease at specific excitation/emission wavelengths (e.g., 390/460 nm) .

  • LC-MS/MS confirmation: Confirm glucuronide formation through liquid chromatography-tandem mass spectrometry .

  • Kinetic analysis: Determine enzyme kinetic parameters (Km, Vmax) using multiple substrate concentrations and protein levels.

It's critical to include proper controls in each experiment: (1) no substrate, (2) no cofactor UDPGA, and (3) no enzyme source. Additionally, researchers should be aware that organic solvents like DMSO, acetonitrile, or ethanol above 5% (v/v) can significantly decrease glucuronidation rates .

How can molecular modeling approaches be applied to study ugt-60 structure-function relationships?

Molecular modeling provides valuable insights into ugt-60 structure-function relationships using the following methodological framework:

  • Homology modeling: Since crystal structures for many UGTs are unavailable, construct homology models using related protein structures as templates. These models can predict the three-dimensional structure of ugt-60 based on sequence homology with proteins of known structure .

  • Substrate binding site analysis: Analyze the putative binding pocket to identify key residues involved in substrate recognition. This can guide the design of selective substrates or inhibitors .

  • Molecular docking: Perform in silico docking of potential substrates to predict binding modes and affinities. This approach can help prioritize compounds for experimental validation .

  • Molecular dynamics simulations: Conduct simulations to understand protein flexibility and conformational changes upon substrate binding, which are crucial for catalytic activity.

  • Site-directed mutagenesis validation: Test computational predictions by creating specific mutations (e.g., H210M) and assessing their effects on substrate specificity and catalytic efficiency .

When applying these approaches to ugt-60, researchers should consider the evolutionary conservation between C. elegans and human UGTs to make meaningful comparisons and predictions.

How do hetero-dimerization events affect UGT enzymatic function, and could similar mechanisms apply to ugt-60?

Hetero-dimerization significantly impacts UGT enzymatic function through several mechanisms that may apply to ugt-60:

  • Altered substrate specificity: Hetero-dimerization between different UGT isoforms can modify the substrate recognition profile. For example, when UGT1A1, 1A9, and 2B7 form hetero-dimers, their substrate preferences change compared to their respective homo-dimers .

  • Kinetic parameter modulation: Protein-protein interactions alter Km and Vmax values, directly affecting enzymatic efficiency. In human UGTs, these changes vary depending on the specific hetero-dimer combination .

  • Regioselectivity changes: Hetero-dimerization can modify the regioselectivity of glucuronidation. For instance, UGT1A9's regioselectivity for quercetin glucuronidation changes upon dimerization with other UGTs .

  • Polymorphism effects: Genetic variants within UGT proteins show variable FRET efficiencies and donor-acceptor distances, suggesting that polymorphisms alter the affinity and conformation of protein-protein interactions .

To investigate whether similar mechanisms apply to ugt-60, researchers should:

  • Employ fluorescence resonance energy transfer (FRET) techniques to detect protein-protein interactions

  • Perform co-immunoprecipitation (Co-IP) assays to confirm stable interactions

  • Develop double expression systems to study the functional consequences of hetero-dimerization

  • Compare glucuronidation activities of ugt-60 alone versus in combination with other UGTs

Understanding these mechanisms is crucial for accurately predicting drug metabolism and potential drug-drug interactions in both model organisms and humans.

What is the impact of genetic polymorphisms on ugt-60 function and how can these be characterized?

Genetic polymorphisms can significantly impact ugt-60 function through multiple mechanisms that require comprehensive characterization:

  • Functional impact assessment:

    • Compare wild-type and variant proteins for altered kinetic parameters (Km, Vmax)

    • Analyze changes in substrate specificity profiles

    • Evaluate potential impacts on protein stability and expression levels

  • Characterization methods:

    • Site-directed mutagenesis: Create specific mutations to mimic naturally occurring variants

    • Enzyme kinetics: Determine kinetic parameters for various substrates with different variants

    • Protein structure analysis: Assess how mutations affect protein folding and stability

    • Hetero-dimerization studies: Evaluate how polymorphisms alter protein-protein interactions

  • Polymorphism identification:

    • Sequence analysis of the ugt-60 gene in different C. elegans strains

    • Comparison with human UGT polymorphisms to identify conserved mutation hotspots

Based on studies of human UGTs, polymorphisms can affect enzyme function in complex ways. For example, the H210M mutation in UGT1A10 caused variable effects on substrate specificity and catalytic efficiency, with some substrates showing increased Km values while others exhibited decreased values . This suggests that similar mutations in ugt-60 might have substrate-dependent effects that require comprehensive characterization across multiple model substrates.

The table below illustrates how polymorphisms can affect kinetic parameters, using human UGT1A10 wild-type and mutant data as an example:

CompoundUGT1A10 Wild-typeUGT1A10 MutantEffect on Efficiency
Km (μM)Vmax (μmol/min/g prot)Km (μM)Vmax (μmol/min/g prot)Vmax/Km (L/min/g prot) change
110.7313.58.7-14%
22.25.97.86.3-70%
38.322.33.89.5-7%
42.815.34.76.5-75%
52.816.24.65.9-78%
67.05.326.86.3-68%
HFC1415.132.911.7-67%

This table demonstrates how a single amino acid change can differentially affect the enzyme's interaction with various substrates, highlighting the complexity of structure-function relationships in UGTs .

How do expression systems influence the functional characteristics of recombinant ugt-60?

The choice of expression system significantly influences the functional characteristics of recombinant ugt-60 through multiple factors:

  • Prokaryotic vs. Eukaryotic Systems:

    • E. coli systems (as used for recombinant ugt-60 ) provide high yield but lack post-translational modifications

    • Insect cell systems (Bac-to-Bac) offer better protein folding and some post-translational modifications

    • Mammalian cell systems provide the most physiologically relevant modifications but at lower yields

  • Impact on Protein Characteristics:

    • Glycosylation patterns vary between expression systems, potentially affecting protein stability and activity

    • Membrane association capability differs, influencing proper localization of the enzyme

    • Co-factor availability and endogenous protein interactions vary between systems

  • Experimental Considerations:

    • For activity studies, baculovirus-infected insect cells are frequently employed for UGT expression

    • For structural studies requiring high purity, E. coli systems with affinity tags (His-tag) provide easier purification

    • For dimerization studies, co-expression systems in insect cells allow for controlled hetero-dimerization experiments

  • Methodological Recommendations:

    • When studying catalytic activity, compare results between different expression systems to identify system-dependent artifacts

    • For hetero-dimerization studies, use dual expression vectors or co-infection approaches in insect cells

    • Include appropriate controls for post-translational modifications when comparing activities between different expression systems

Researchers should carefully select expression systems based on their specific experimental goals, recognizing that functional characteristics may vary across systems due to differences in protein processing and cellular environment.

How does ugt-60 compare with human UDP-glucuronosyltransferases in terms of substrate specificity and function?

Comparing ugt-60 from C. elegans with human UDP-glucuronosyltransferases reveals important similarities and differences in substrate specificity and function:

  • Evolutionary Relationship:

    • C. elegans ugt-60 shares structural homology with human UGTs, particularly in the C-terminal domain that contains the UDP-glucuronic acid binding site

    • Divergence in the N-terminal domain explains species-specific substrate preferences

  • Substrate Specificity Comparison:

    • Human UGT1A10 shows selectivity for phenolic compounds, hydroxycoumarins, and flavonoids

    • Human UGT1A1 primarily catalyzes bilirubin glucuronidation with broader substrate specificity

    • C. elegans ugt-60 substrate profile is less characterized but likely includes endogenous compounds important for nematode metabolism

  • Functional Comparison:

    • Human UGTs demonstrate tissue-specific expression patterns, with UGT1A10 predominantly in intestine and UGT1A1 in liver

    • Tissue distribution of ugt-60 in C. elegans provides insights into its physiological role

    • Both human UGTs and ugt-60 likely fulfill detoxification functions but may have evolved to handle different xenobiotics based on ecological niches

  • Methodological Approach for Comparison:

    • Screen a diverse substrate panel across both human UGTs and ugt-60

    • Compare kinetic parameters (Km, Vmax) for shared substrates

    • Analyze structural models to identify conserved and divergent binding site residues

    • Perform chimeric protein studies to determine which domains confer substrate specificity

This comparative analysis provides valuable information for researchers using C. elegans as a model organism for toxicology studies and helps identify the extent to which metabolic findings can be translated between species.

What are the optimal experimental designs for studying ugt-60 dimerization and its functional implications?

Optimal experimental designs for studying ugt-60 dimerization require a multi-technique approach:

  • Fluorescence Resonance Energy Transfer (FRET):

    • Tag ugt-60 with compatible fluorophore pairs (e.g., CFP/YFP or GFP/RFP)

    • Measure FRET efficiencies and calculate donor-acceptor distances

    • Analyze how mutations affect protein-protein interaction distances

    • Advantages: Provides spatial information about protein interactions in live cells

    • Limitations: Requires careful controls for direct excitation and spectral bleed-through

  • Co-immunoprecipitation (Co-IP):

    • Express differentially tagged versions of ugt-60 (e.g., His-tag and FLAG-tag)

    • Immunoprecipitate with one tag and detect the presence of the other

    • Include appropriate negative controls (non-interacting proteins)

    • Advantages: Confirms physical interaction between proteins

    • Limitations: Does not provide spatial information

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split a fluorescent protein and fuse each half to potential interacting partners

    • Fluorescence only occurs upon protein-protein interaction

    • Advantages: High sensitivity and ability to visualize interaction localization

    • Limitations: Irreversible nature of fluorophore complementation

  • Functional Activity Assays in Double Expression Systems:

    • Co-express ugt-60 with potential dimerization partners

    • Compare enzymatic activities with individually expressed proteins

    • Analyze changes in substrate specificity, regioselectivity, and kinetic parameters

    • Advantages: Directly links dimerization to functional outcomes

    • Limitations: Cannot distinguish direct from indirect effects

An integrated experimental workflow should:

  • First confirm physical interaction (Co-IP, FRET)

  • Characterize interaction details (FRET distances, BiFC localization)

  • Determine functional consequences (activity assays)

  • Validate with mutational analysis to identify critical interaction domains

This comprehensive approach provides robust evidence for dimerization and its functional implications for ugt-60.

How can advanced spectroscopic methods be applied to study ugt-60 structure and substrate binding?

Advanced spectroscopic methods offer powerful tools for investigating ugt-60 structure and substrate binding with high resolution and sensitivity:

  • Circular Dichroism (CD) Spectroscopy:

    • Methodology: Measure differential absorption of left and right circularly polarized light

    • Applications:

      • Determine secondary structure composition (α-helices, β-sheets)

      • Monitor conformational changes upon substrate binding

      • Assess thermal stability and folding/unfolding transitions

    • Experimental design: Compare CD spectra of ugt-60 alone and in complex with substrates/cofactors

  • Fluorescence Spectroscopy:

    • Methodology: Exploit intrinsic tryptophan fluorescence or external fluorescent probes

    • Applications:

      • Monitor substrate binding through quenching of intrinsic fluorescence

      • Study protein dynamics using fluorescence lifetime measurements

      • Track conformational changes via fluorescence anisotropy

    • Experimental design: Measure fluorescence spectra with varying substrate concentrations to determine binding constants

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Methodology: Isotopically label (¹⁵N, ¹³C) recombinant ugt-60 for structural analysis

    • Applications:

      • Map substrate binding sites through chemical shift perturbations

      • Analyze protein dynamics at residue-level resolution

      • Determine solution structure of protein domains

    • Experimental design: Compare HSQC spectra before and after substrate addition

  • Surface Plasmon Resonance (SPR):

    • Methodology: Immobilize ugt-60 on sensor chip and flow substrates/cofactors

    • Applications:

      • Determine binding kinetics (kon, koff) and equilibrium constants

      • Study temperature-dependence of interactions

      • Analyze the impact of mutations on binding properties

    • Experimental design: Perform multi-cycle or single-cycle kinetic experiments

  • Isothermal Titration Calorimetry (ITC):

    • Methodology: Measure heat changes during binding events

    • Applications:

      • Determine thermodynamic parameters (ΔH, ΔS, ΔG)

      • Distinguish enthalpy-driven from entropy-driven interactions

      • Quantify binding stoichiometry

    • Experimental design: Titrate substrate into protein solution and measure heat changes

What roles do somatic mutations in the ugt-60 gene play in metabolic disorders, and how can they be studied?

Somatic mutations in the ugt-60 gene may significantly impact metabolic pathways in C. elegans, providing insights into human UGT-related disorders. A comprehensive research strategy includes:

  • Mutation Identification and Characterization:

    • Conduct whole-genome or targeted sequencing of C. elegans strains with metabolic phenotypes

    • Analyze mutation patterns to identify hotspots and recurring variants

    • Compare with human UGT mutation databases to find evolutionarily conserved sites

    • Develop a comprehensive mutation catalog including single nucleotide variants (SNVs) and indels

  • Functional Impact Assessment:

    • Generate CRISPR/Cas9-mediated knock-in models carrying specific mutations

    • Measure changes in enzyme activity using fluorescence-based assays

    • Analyze metabolite profiles through targeted and untargeted metabolomics

    • Assess developmental and physiological phenotypes in mutant worms

  • Systems Biology Approach:

    • Perform transcriptomics to identify compensatory mechanisms activated in mutants

    • Use proteomics to detect changes in protein-protein interaction networks

    • Conduct flux analysis to quantify alterations in metabolic pathways

    • Integrate multi-omics data to build comprehensive models of mutation effects

  • Translational Research Applications:

    • Establish correlations between C. elegans phenotypes and human metabolic disorders

    • Use high-throughput drug screening to identify compounds that rescue mutant phenotypes

    • Develop predictive models for human UGT mutation impacts based on C. elegans data

The methodology should include both targeted experiments on specific mutations and broader screens to identify novel mutation-phenotype relationships. By systematically characterizing ugt-60 mutations, researchers can gain valuable insights into the fundamental role of UGTs in metabolism and potentially identify therapeutic targets for human metabolic disorders .

How can ugt-60 be utilized as a model for studying the evolution of detoxification systems across species?

UDP-glucuronosyltransferase ugt-60 from C. elegans provides an excellent model for evolutionary studies of detoxification systems through several methodological approaches:

  • Comparative Genomics Framework:

    • Align ugt-60 sequences with UGTs from diverse organisms (bacteria, plants, invertebrates, vertebrates)

    • Construct phylogenetic trees to trace evolutionary relationships

    • Identify conserved catalytic domains versus rapidly evolving substrate-binding regions

    • Map selection pressures across different protein domains using dN/dS ratios

  • Functional Evolution Analysis:

    • Express orthologous UGTs from different species in a common system

    • Compare substrate specificity profiles across evolutionary distance

    • Identify substrate classes that are conserved versus species-specific

    • Correlate functional differences with ecological niches and exposure to xenobiotics

  • Ancestral Sequence Reconstruction:

    • Computationally infer ancestral UGT sequences at key evolutionary nodes

    • Express reconstructed proteins and characterize their functions

    • Track the emergence of new catalytic capabilities through evolutionary time

    • Identify critical mutations that enabled functional diversification

  • Experimental Evolution Approaches:

    • Subject C. elegans populations to xenobiotic challenges over multiple generations

    • Sequence ugt-60 alleles before and after selection

    • Characterize functional changes in evolved variants

    • Model how detoxification systems adapt to new chemical challenges

This research framework provides insights into how detoxification enzymes evolve in response to environmental challenges and helps predict how organisms might adapt to new xenobiotics, with applications in evolutionary biology, toxicology, and environmental science.

What are the current challenges in developing selective substrates for ugt-60, and how can these be overcome?

Developing selective substrates for ugt-60 faces several challenges that require innovative approaches to overcome:

  • Current Challenges:

    • Limited structural information about ugt-60's active site

    • Overlapping substrate specificity with other UGT family members

    • Difficulty in predicting structure-activity relationships

    • Limited availability of high-throughput screening methods

  • Methodological Solutions:

    • Structure-Based Design:

      • Develop refined homology models based on available UGT crystal structures

      • Perform molecular dynamics simulations to identify flexible binding site regions

      • Use fragment-based approaches to identify building blocks with affinity for ugt-60

      • Design C3-substituted coumarin derivatives with moieties that interact with ugt-60-specific residues

    • Fluorescence-Based Substrate Development:

      • Synthesize libraries of fluorescent compounds with structural variations

      • Measure glucuronidation rates through fluorescence decrease

      • Optimize excitation/emission properties for high sensitivity

      • Design quenching mechanisms that activate only upon glucuronidation

    • High-Throughput Screening:

      • Develop miniaturized assays in 384-well formats

      • Create substrate libraries with systematic structural variations

      • Implement parallel screening against multiple UGTs to identify selective compounds

      • Use statistical approaches to identify structure-selectivity relationships

  • Case Study: Success with C3-Substituted 7-Hydroxycoumarins:
    Human UGT1A10-selective substrates were developed by introducing C3 substitutions (4-fluorophenyl, 4-hydroxyphenyl, 4-methoxyphenyl, 4-(dimethylamino)phenyl, 4-methylphenyl, or triazole) to 7-hydroxycoumarin. The triazole derivative could be stabilized by H210 in UGT1A10 but not by M213 in UGT1A1, demonstrating how structural knowledge can guide selective substrate design .

Similar approaches can be applied to ugt-60, focusing on identifying unique residues in its binding site that differ from other C. elegans UGTs, and designing substrates that specifically interact with these residues.

How can innovative high-throughput screening methodologies be developed for ugt-60 inhibitor discovery?

Innovative high-throughput screening (HTS) methodologies for ugt-60 inhibitor discovery require sophisticated experimental designs that balance throughput with relevance:

  • Fluorescence-Based Primary Screening Strategies:

    • Develop a miniaturized assay using selective fluorescent substrates

    • Monitor glucuronidation through fluorescence quenching in real-time

    • Implement automated liquid handling for 384 or 1536-well formats

    • Establish robust statistical parameters (Z' factor >0.5) for hit identification

    • Design counter-screens with related UGTs to assess selectivity early

  • Advanced Confirmation and Characterization Methods:

    • LC-MS/MS Validation:

      • Confirm hits using quantitative analysis of glucuronide formation

      • Determine inhibition mechanisms (competitive, non-competitive, uncompetitive)

      • Establish structure-activity relationships through analog testing

      • Calculate IC50 and Ki values for promising compounds

    • Surface Plasmon Resonance (SPR) Binding Assays:

      • Immobilize ugt-60 on sensor chips

      • Screen binding kinetics of hit compounds

      • Differentiate between high-affinity slow off-rate inhibitors and transient binders

      • Provide orthogonal validation of hits from activity-based screens

  • Specialized Screening Approaches:

    • Fragment-Based Screening:

      • Screen libraries of low molecular weight compounds (<300 Da)

      • Identify binding fragments using NMR, thermal shift assays, or SPR

      • Link or grow fragments to develop high-affinity inhibitors

      • Optimize physicochemical properties through medicinal chemistry

    • Virtual Screening Integration:

      • Perform in silico docking of compound libraries against ugt-60 homology models

      • Prioritize compounds for experimental testing based on predicted binding energies

      • Use machine learning to refine virtual screening models based on experimental results

      • Implement iterative cycles of virtual and experimental screening

  • Innovative Readout Technologies:

    • FRET-Based Assays:

      • Design substrate-based FRET pairs that change upon glucuronidation

      • Monitor energy transfer efficiency in real-time

      • Achieve higher sensitivity than traditional fluorescence quenching

      • Enable ratiometric measurements for reduced artifacts

    • Bioluminescence Resonance Energy Transfer (BRET):

      • Develop BRET-based ugt-60 activity sensors

      • Provide higher sensitivity with lower background than fluorescence-based methods

      • Eliminate the need for excitation light, reducing compound interference

      • Enable cell-based screening approaches

These innovative methodologies will accelerate the discovery of selective ugt-60 inhibitors while providing detailed mechanistic insights, ultimately advancing both basic research and potential therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.