Recombinant Putative uroporphyrinogen-III C-methyltransferase (hemX)

Shipped with Ice Packs
In Stock

Description

Introduction to Uroporphyrinogen-III C-Methyltransferase

Uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107), also known as uroporphyrinogen methyltransferase, is an enzyme that catalyzes two methylation reactions . This enzyme plays a critical role in the biosynthesis of cobalamin (vitamin B12) in both anaerobic and aerobic bacteria . The systematic name for this enzyme is S-adenosyl-L-methionine:uroporphyrinogen-III C-methyltransferase . Other names include SirA, CysG, and CobA .

Reaction Catalyzed

  1. S-adenosyl-L-methionine + uroporphyrinogen III $$ \rightleftharpoons $$ S-adenosyl-L-homocysteine + precorrin-1

  2. S-adenosyl-L-methionine + precorrin-1 $$ \rightleftharpoons $$ S-adenosyl-L-homocysteine + precorrin-2

Biological Role and Significance

Uroporphyrinogen-III C-methyltransferase catalyzes two methylation reactions . The first reaction converts uroporphyrinogen III into precorrin-1 . The second converts precorrin-1 into precorrin-2 . These reactions are part of the biosynthetic pathway to cobalamin (vitamin B~12~) in both anaerobic and aerobic bacteria . Cobalamin is essential for various metabolic processes, including DNA synthesis and energy production .

Enzyme classification

Uroporphyrinogen-III C-methyltransferase is classified under EC number 2.1.1, which includes enzymes that catalyze the transfer of one-carbon groups . Specifically, EC 2.1.1.107 denotes its activity in methylating uroporphyrinogen-III .

Synonyms

Uroporphyrinogen-III C-methyltransferase is known by several other names, including :

  • Uroporphyrinogen methyltransferase

  • Uroporphyrinogen-III methyltransferase

  • Adenosylmethionine-uroporphyrinogen III methyltransferase

  • S-adenosyl-L-methionine-dependent uroporphyrinogen III methylase

  • Uroporphyrinogen-III methylase

  • SirA

  • CysG

  • CobA

  • Uroporphyrin-III C-methyltransferase

  • S-adenosyl-L-methionine:uroporphyrin-III C-methyltransferase

Practical Applications and Research

Recombinant forms of HemX are available for research purposes . These recombinant proteins are useful in studying enzyme function, reaction mechanisms, and potential applications in biotechnology .

HemX in Metabolic Pathways

The enzyme HemX is involved in heme biosynthesis . Heme is a crucial molecule with various functions, including electronic reactions and gas binding, making it useful in medical treatments and dietary supplements .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
hemX; Protein HemX; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Proteus mirabilis
Target Names
hemX
Target Protein Sequence
MTEQKNTNENDLQNGTSKADDDIRYQEVKPVNNKRSGLIGSAVAILVILAIGGGLYYYTT QQATKLRDPDHLLSDNENPGITCALIPTDVKGVEIGHRHFPLNVPFMNGPTRGKDVFVPI DFIIGGPKMAGQGWRMLVECLSVGRGITLPSNSTGGLKSAAMATGATLEF
Uniprot No.

Target Background

Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the biochemical function of uroporphyrinogen-III C-methyltransferase (hemX)?

Uroporphyrinogen-III C-methyltransferase (hemX) is an enzyme that catalyzes the methylation of uroporphyrinogen III to form precorrin-2, a critical intermediate in several biosynthetic pathways. Specifically, hemX catalyzes a two-step methylation reaction:

  • The first reaction converts uroporphyrinogen III into precorrin-1 using S-adenosyl-L-methionine as a methyl donor

  • The second reaction methylates precorrin-1 to form precorrin-2, again using S-adenosyl-L-methionine

These enzymatic steps are essential for the biosynthesis of tetrapyrrole compounds including cobalamin (vitamin B12) in both aerobic and anaerobic bacteria . Research has demonstrated that hemX plays a crucial role in the heme biosynthesis pathway in several bacterial species, particularly in Haemophilus species where it may contribute to haemin dependence or independence .

How does hemX differ from other uroporphyrinogen methyltransferases?

While hemX belongs to the family of uroporphyrinogen methyltransferases, it is specifically associated with certain bacterial species, particularly Haemophilus. Other related enzymes in this family include:

  • SirA: Involved in siroheme biosynthesis

  • CysG: A multifunctional enzyme in some bacteria that combines methyltransferase activity with other functions

  • CobA: Specifically involved in cobalamin biosynthesis

The key distinction of hemX lies in its genomic context and phylogenetic distribution. Comparative genomic analyses have revealed that hemX is frequently found in haemin-independent Haemophilus species but is absent in strictly haemin-dependent strains . This suggests a specialized role in heme biosynthesis pathways that varies between bacterial species and strains.

What are the optimal conditions for expressing recombinant hemX in bacterial systems?

When designing expression systems for recombinant hemX, researchers should consider the following parameters:

Expression System Selection:

  • E. coli BL21(DE3) is commonly used for initial expression attempts

  • Consider using specialized strains with rare codon supplementation if the hemX sequence contains numerous rare codons

  • For proper folding, Rosetta or Origami strains may improve soluble protein yield

Expression Conditions:

  • Induction: IPTG concentration of 0.1-0.5 mM typically yields better soluble protein than higher concentrations

  • Temperature: Lower induction temperatures (16-20°C) often result in more soluble protein compared to standard 37°C

  • Duration: Extended expression periods (16-24 hours) at lower temperatures may improve yield

  • Media: Enriched media such as Terrific Broth can increase biomass and protein yield

Purification Strategy:

  • N-terminal His-tag generally shows less interference with enzymatic activity than C-terminal tagging

  • Include adequate quantities of reducing agents (1-5 mM DTT or β-mercaptoethanol) in all purification buffers

  • Maintain 10-20% glycerol in storage buffers to preserve enzyme activity

For optimal activity measurement, ensure the availability of S-adenosyl-L-methionine as the methyl donor and uroporphyrinogen III as the substrate, both of which should be freshly prepared or properly stored to maintain their integrity.

What experimental design approaches are most effective for studying hemX activity in vitro?

When designing experiments to study hemX activity, consider the following methodological approaches:

Spectrophotometric Assays:

  • Monitor the conversion of uroporphyrinogen III to precorrin-2 by tracking changes in absorbance spectra

  • The reaction can be followed at specific wavelengths that distinguish substrate from products

HPLC Analysis:

  • Develop a reverse-phase HPLC method to separate and quantify reaction products

  • Use fluorescence detection for increased sensitivity when working with low enzyme concentrations

Experimental Design Table for hemX Activity Studies:

ParameterBasic ApproachAdvanced Approach
Substrate concentrationFixed concentration (50-100 μM)Varying concentrations (10-500 μM) for kinetic analysis
Enzyme concentrationSingle concentration (1-5 μg/mL)Multiple concentrations to ensure linearity
Time pointsEndpoint measurementMultiple time points (0, 5, 15, 30, 60 min)
TemperatureStandard (25°C or 37°C)Temperature range (20-45°C) for optimum determination
pHBuffer at pH 7.4pH range (6.0-9.0) with appropriate buffers
ControlsNo enzyme controlHeat-inactivated enzyme, competitive inhibitors

For rigorous kinetic analysis, I recommend utilizing a factorial experimental design to simultaneously evaluate multiple variables and their interactions . This approach can reveal conditional dependencies that might be missed in traditional one-factor-at-a-time experiments.

How can comparative genomics be used to identify and characterize hemX in bacterial species?

Comparative genomic approaches provide powerful tools for identifying and characterizing hemX across different bacterial species:

Sequence-Based Identification:

  • Start with well-characterized hemX sequences as queries for BLAST searches against genomic databases

  • Apply tBLASTn using translated protein sequences against nucleotide databases to identify potential hemX homologs

  • Manually review genome assembly annotations to confirm the presence of hemX and related heme biosynthesis genes

  • Examine the genomic context of putative hemX genes, as they are often co-located with other genes involved in tetrapyrrole biosynthesis

Phylogenetic Analysis Strategy:

  • Collect hemX sequences from diverse bacterial species, particularly focusing on Haemophilus species

  • Perform multiple sequence alignment using MUSCLE or MAFFT algorithms

  • Construct phylogenetic trees using maximum likelihood or Bayesian methods

  • Correlate the phylogenetic distribution with phenotypic characteristics like haemin dependence

Comparative genomic analysis has successfully demonstrated that hemX presence correlates with haemin independence in Haemophilus species, providing valuable insights into the evolutionary adaptation of heme acquisition and biosynthesis pathways .

What bioinformatic approaches help predict structure-function relationships in hemX?

Advanced bioinformatic approaches can reveal important insights into hemX structure-function relationships:

Structural Analysis:

  • Homology modeling based on related methyltransferases with solved crystal structures

  • Molecular docking of substrates (uroporphyrinogen III and S-adenosyl-L-methionine) to identify key interaction residues

  • Molecular dynamics simulations to evaluate substrate binding and conformational changes

Functional Domain Prediction:

  • Identify conserved S-adenosyl-L-methionine binding motifs

  • Map substrate-binding regions through conservation analysis

  • Predict catalytic residues through comparison with other methyltransferases

Integrative Approaches:

  • Combine sequence conservation analysis with structural predictions

  • Correlate natural variation in hemX sequences with enzymatic properties

  • Use co-evolution analysis to identify potential protein-protein interaction sites

These bioinformatic predictions should be experimentally validated through site-directed mutagenesis of predicted key residues and subsequent activity assays to confirm their functional roles.

How can the hemX pathway be exploited for metabolic engineering of tetrapyrrole compounds?

The hemX pathway offers several opportunities for metabolic engineering to enhance production of valuable tetrapyrrole compounds:

Pathway Engineering Strategies:

  • Overexpression of hemX along with other rate-limiting enzymes in the pathway

  • Optimization of S-adenosyl-L-methionine regeneration to maintain methylation capacity

  • Modification of regulatory elements to prevent feedback inhibition

  • Introduction of hemX into haemin-dependent strains to potentially convert them to haemin-independent phenotypes

Potential Applications:

  • Enhancement of vitamin B12 (cobalamin) production in bacterial systems

  • Development of novel biosensors based on tetrapyrrole intermediates

  • Engineering of bacteria for improved survival in haemin-limited environments

When designing such metabolic engineering experiments, researchers should carefully consider the balance of the entire pathway, as accumulation of certain tetrapyrrole intermediates can be toxic to cells. A systematic approach involving gradual optimization of multiple enzymatic steps typically yields better results than simply overexpressing hemX alone .

What are the implications of hemX variation in bacterial pathogenesis and antibiotic resistance?

The presence or absence of functional hemX can significantly impact bacterial pathogenesis and potentially influence antibiotic resistance:

Pathogenesis Implications:

  • Haemin-independent strains (containing functional hemX) may have advantages in colonizing tissues where free heme is limited

  • The ability to synthesize heme independently may influence virulence by supporting growth in restrictive host environments

  • Comparative genomic analyses have shown that hemX-containing Haemophilus strains exhibit distinct phylogenomic placement compared to haemin-dependent strains

Potential Connections to Antibiotic Resistance:

  • Heme biosynthesis pathways may interact with mechanisms of resistance to certain antibiotics

  • Targeting hemX or related enzymes could represent a novel approach for developing antimicrobial compounds

  • The presence of hemX may influence bacterial metabolism in ways that affect susceptibility to existing antibiotics

Research Approaches:

  • Generate hemX knockout mutants and assess changes in virulence and antibiotic susceptibility

  • Perform comparative transcriptomics of hemX-positive and hemX-negative strains under various antibiotic pressures

  • Develop small molecule inhibitors specific to hemX and evaluate their antimicrobial potential

These research directions could lead to new insights into bacterial adaptation mechanisms and potentially reveal novel therapeutic targets.

What are common challenges in hemX activity assays and how can they be addressed?

Researchers frequently encounter several challenges when working with hemX activity assays:

Challenge 1: Substrate Instability

  • Problem: Uroporphyrinogen III is highly oxygen-sensitive

  • Solution: Perform assays under strict anaerobic conditions using anaerobic chambers or by purging solutions with inert gas. Include reducing agents like DTT or glutathione in reaction buffers.

Challenge 2: Product Detection

  • Problem: Distinguishing between precorrin-1 and precorrin-2 intermediates

  • Solution: Develop HPLC methods with appropriate standards for separation. Consider using mass spectrometry for definitive identification of reaction products.

Challenge 3: Enzyme Inactivation

  • Problem: Loss of hemX activity during purification or storage

  • Solution: Include stabilizing agents (glycerol, reducing agents) in all buffers. Consider fusion tags that enhance stability, and store enzyme preparations in small aliquots at -80°C to avoid freeze-thaw cycles.

Challenge 4: Assay Interference

  • Problem: Components in crude extracts may interfere with activity measurements

  • Solution: Include appropriate controls with heat-inactivated enzyme. Consider using purified enzyme preparations for definitive kinetic measurements.

Implementing a systematic approach to troubleshooting, where each variable is carefully controlled and tested, will help identify and resolve specific issues in your experimental system.

How can contradictory findings in hemX research be reconciled through experimental design?

When faced with contradictory findings in hemX research, consider the following approaches to reconcile discrepancies:

Methodological Reconciliation:

  • Standardize Experimental Conditions: Ensure that key parameters (pH, temperature, buffer composition) are consistent across studies

  • Validate Enzyme Identity and Purity: Confirm the sequence and purity of the hemX preparation through mass spectrometry and activity verification

  • Cross-Laboratory Validation: Perform parallel experiments in different laboratories using standardized protocols

Experimental Design for Resolving Contradictions:

  • Implement factorial experimental designs that systematically vary multiple parameters to identify conditional dependencies

  • Use response surface methodology to map the complete landscape of enzyme activity across multiple variables

  • Consider species-specific or strain-specific differences in hemX function that might explain divergent results

Data Analysis Approaches:

  • Utilize meta-analysis techniques to integrate results from multiple studies

  • Apply Bayesian statistical methods to quantify uncertainty and reconcile apparently contradictory findings

  • Develop mathematical models that can accommodate different experimental conditions

These systematic approaches can help determine whether contradictory findings represent actual biological variation or stem from methodological differences, ultimately leading to a more comprehensive understanding of hemX function across different contexts.

What emerging technologies could advance hemX research?

Several cutting-edge technologies hold promise for advancing our understanding of hemX:

CRISPR-Cas9 Genome Editing:

  • Precise modification of hemX in diverse bacterial species

  • Creation of conditional hemX expression systems to study its essentiality

  • Combinatorial editing of multiple genes in tetrapyrrole biosynthesis pathways

Cryo-EM and Advanced Structural Biology:

  • Determination of high-resolution structures of hemX complexed with substrates

  • Visualization of conformational changes during catalysis

  • Structural characterization of hemX in complex with other pathway enzymes

Single-Cell Technologies:

  • Analysis of hemX expression heterogeneity within bacterial populations

  • Correlation of hemX activity with single-cell phenotypes

  • Real-time monitoring of tetrapyrrole biosynthesis at the single-cell level

Systems Biology Approaches:

These technologies promise to deepen our understanding of hemX beyond what conventional approaches have achieved thus far.

How might understanding hemX contribute to synthetic biology applications?

The study of hemX offers several promising applications in synthetic biology:

Designer Tetrapyrrole Production:

  • Engineering synthetic pathways incorporating hemX for production of novel tetrapyrrole structures

  • Creation of tunable hemX variants with altered substrate specificity

  • Development of light-responsive tetrapyrrole-based genetic circuits

Bacterial Chassis Engineering:

  • Incorporation of hemX pathways into minimal genome bacteria for specialized functions

  • Development of bacterial strains with enhanced survival in diverse environments through optimized heme biosynthesis

  • Creation of robust production platforms for cobalamin and other tetrapyrrole derivatives

Biosensor Development:

  • Design of hemX-based biosensors for detecting specific metabolites

  • Development of whole-cell biosensors using tetrapyrrole-responsive transcription factors

  • Creation of diagnostic tools for detecting pathogens based on hemX presence or activity

The foundational knowledge gained from detailed studies of hemX structure, function, and regulation will enable these synthetic biology applications, potentially leading to innovations in biomanufacturing, environmental monitoring, and medical diagnostics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.