Recombinant Putative zinc metalloprotease CPE1693 (CPE1693)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Putative Zinc Metalloprotease CPE1693 (CPE1693)

Recombinant Putative zinc metalloprotease CPE1693 (CPE1693) is a zinc-dependent protease, belonging to the metalloproteinase (MP) family . Metalloproteinases are a family of zinc-dependent proteases that include matrix metalloproteinases (MMPs), a disintegrin and metalloproteases (ADAMs), and a disintegrin and metalloproteinase with thrombospondin motifs (ADAMTSs) . These enzymes play a crucial role in the remodeling and degradation of the extracellular matrix (ECM) .

Function and Role

Metalloproteinases, including CPE1693, have a wide range of substrates, including ECM components, chemokines, cell receptors, and growth factors . These proteases are involved in various biological processes, such as ECM remodeling, cell signaling, and immune response . Metalloproteinases' activities are tightly regulated by proteolytic activation and inhibition via their natural inhibitors, tissue inhibitors of metalloproteinases (TIMPs), and the imbalance of the activation and inhibition is responsible in progression or inhibition of several diseases, e.g., cancer, neurological disorders, and cardiovascular diseases .

Identification of Novel Zinc Metalloprotease

Through a global analysis of Clostridium difficile extracellular proteins, a novel zinc metalloprotease, named Zmp1, was identified . Zmp1 binds zinc and is able to cleave fibronectin and fibrinogen in vitro in a zinc-dependent manner . Site-directed mutagenesis identified residues important in zinc binding and enzymatic activity, and it was demonstrated that Zmp1 destabilizes the fibronectin network produced by human fibroblasts .

Zmp1 Activity and Specificity

Zmp1 demonstrates a zinc-dependent activity in vitro . Mutating residues in the HEXXH motif, a conserved motif typical to zinc metalloproteases and crucial for proteolytic activity, demonstrates that residues E143 and H146 are important for the catalytic activity of Zmp1 . NMR and DSF analyses show that H146 is required for binding to Zn2+, while mutations in both residues affect activity on plasma fibronectin and fibrinogen in vitro . Zmp1 is active on fibrinogen Bβ-chains and fibronectin, but not on other substrates such as casein or different collagen types that were tested .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CPE1693; Putative zinc metalloprotease CPE1693
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Clostridium perfringens (strain 13 / Type A)
Target Names
CPE1693
Target Protein Sequence
MYIIFALLAFSALILVHELGHFIVAKLNGIYVEEFAIGMGPKLFGVKVGETEYNLRILPF GGFVKMLGEEDESDDSRSLNAKTPIQRILVMGAGAFMNYVLALIIFIGLAMSSGFAENKV ASVVPNSPAQEIGIEQGDEFLKIDGNKIHTTDDFRMGLALAKGNPVELEIKRGNDVLTKT VQPILNESGMYQVGISYALVEKPTLLQGIKQGFNETRSLVSQSFIALKTIVTGEANLKTD VGGPVTIIKMSGQAAKAGANTLLWFMAFLSVQLAVFNLLPFPALDGGRIFIELIQMIIRK EIPAKYIEAVNTVGFMLLMGLMVLVTIKDIIFPIL
Uniprot No.

Target Background

Database Links

KEGG: cpe:CPE1693

Protein Families
Peptidase M50B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the fundamental structural characteristics of zinc metalloproteases like CPE1693?

Zinc metalloproteases like CPE1693 typically contain the characteristic HEXXH 'zincin' motif that is essential for their catalytic activity. This motif coordinates the zinc ion in the active site through the two histidine residues, while the glutamate serves as a catalytic base during peptide bond hydrolysis. Similar zinc metalloproteases, such as those found in Burkholderia species, are expressed as preproenzymes that undergo autocatalytic cleavage to form mature enzymes. For instance, ZmpB is expressed as a 63-kDa preproenzyme precursor that is autocatalytically cleaved into mature ZmpB (35 kDa) and a 27-kDa prepropeptide . When working with CPE1693, researchers should anticipate similar processing events and consider how these might affect experimental design and interpretation.

How does CPE1693 compare to other characterized zinc metalloproteases?

While specific data on CPE1693 requires direct experimentation, comparisons can be drawn with well-characterized zinc metalloproteases. For example, bacterial zinc metalloproteases like ZmpA and ZmpB from Burkholderia cenocepacia show broad substrate specificity, with proteolytic activity against α-1 proteinase inhibitor, α2-macroglobulin, type IV collagen, fibronectin, lactoferrin, transferrin, and immunoglobulins . ZMPSTE24, another zinc metalloprotease, shares structural features with soluble gluzincins despite being an integral membrane protein . When investigating CPE1693, researchers should consider examining its substrate specificity profile and comparing it with these well-characterized metalloproteases to understand evolutionary relationships and functional similarities.

What are the common inhibitors used to characterize zinc metalloproteases like CPE1693?

Zinc metalloproteases are typically inhibited by metal chelators that sequester the catalytic zinc ion. Common inhibitors include EDTA, 1,10-phenanthroline, and sometimes excess Zn²⁺ cations, as observed with ZmpB . Additionally, phosphoramidon, a natural product peptidic inhibitor, has been shown to competitively inhibit various zinc metalloproteases, including the integral membrane protein ZMPSTE24 . When characterizing CPE1693, these inhibitors can be valuable tools for confirming its classification as a zinc metalloprotease and for investigating its active site structure through inhibition kinetics.

What are the optimal approaches for cloning and expressing recombinant CPE1693?

For efficient cloning and expression of recombinant zinc metalloproteases like CPE1693, researchers should consider the following methodology based on successful approaches with similar enzymes:

  • Gene amplification using PCR with primers containing appropriate restriction sites for directional cloning

  • Insertion into expression vectors like pPROEXHTa or pET series for high-level expression

  • Expression in a suitable host such as E. coli BL21(DE3)

For example, when working with ZmpB, researchers successfully used the pPROEXHTa His6 Tag expression system for purification from E. coli . Similarly, the rsep metalloprotease gene was cloned into pET22b+ plasmid and overexpressed in E. coli BL21(DE3) . Optimization of expression conditions including temperature, induction time, and inducer concentration will be necessary for maximizing soluble protein yield.

What purification strategies are most effective for recombinant zinc metalloproteases?

Purification of recombinant zinc metalloproteases typically involves:

  • Affinity chromatography (if the protein contains a histidine tag)

  • Ion exchange chromatography to separate the protein based on charge properties

  • Size exclusion chromatography for final polishing and buffer exchange

When purifying these enzymes, it's important to consider their autocatalytic processing. For instance, ZmpB was expressed as a preproenzyme that autocatalytically cleaved into the mature enzyme . Including appropriate protease inhibitors (avoiding metal chelators if you want to preserve activity) during cell lysis and early purification steps can help prevent unwanted degradation. Researchers should verify protein homogeneity through SDS-PAGE and Western blotting, as was done for ZmpB using antibodies specific to the protein .

How can I develop reliable activity assays for CPE1693?

Development of activity assays for zinc metalloproteases like CPE1693 should include:

  • Selection of appropriate substrates based on the enzyme's predicted specificity (common substrates include casein, collagen, fibronectin, and synthetic peptides)

  • Optimization of reaction conditions (pH, temperature, salt concentration)

  • Inclusion of proper controls (heat-inactivated enzyme, reactions with inhibitors)

For quantitative analysis, researchers might consider using intramolecular quenched-fluorescence fluorogenic peptide assays, which have been successfully employed to determine IC50 values for inhibitors of ZMPSTE24 . Alternatively, for screening purposes, skim milk agar plates can be used to visualize proteolytic activity through the formation of clear zones . Multiple substrates should be tested to fully characterize the enzyme's specificity profile.

How can directed evolution be applied to enhance CPE1693 properties for research applications?

Directed evolution offers a powerful approach to enhance the properties of recombinant metalloproteases like CPE1693. A successful methodology based on recent research includes:

  • Generation of a random mutant gene library using error-prone PCR

  • Cloning of mutant genes into an appropriate expression vector

  • Screening of recombinants for enhanced properties (activity, stability, specificity)

  • Characterization of promising mutants through activity assays and structural studies

A recent study demonstrated that a single round of error-prone PCR could produce a mutant recombinant metalloprotease (rsepA1) with 8.04-fold enhancement in relative protease activity and approximately 4.2-fold improvement in enzymatic efficiency toward casein . This approach could be particularly valuable for enhancing CPE1693's stability, activity, or substrate specificity for specific research applications.

What roles might quorum-sensing systems play in regulating CPE1693 expression?

Research on related zinc metalloproteases suggests that expression regulation through quorum-sensing systems might be relevant for CPE1693. For example, expression of zmpB in B. cenocepacia is regulated by both CepIR and CciIR quorum-sensing systems . This regulation links protease production to bacterial cell density and environmental conditions.

For researchers investigating CPE1693 in its native context, understanding potential quorum-sensing regulation would be crucial. Experimental approaches might include:

  • Analysis of promoter regions for quorum-sensing binding sites

  • Expression studies in quorum-sensing mutant backgrounds

  • Reporter gene assays using the CPE1693 promoter fused to luxCDABE or similar reporter systems

Understanding this regulation is particularly important when interpreting results from in vivo studies or when attempting to optimize recombinant expression.

What structural approaches are most informative for understanding CPE1693 function?

For comprehensive structural characterization of CPE1693, researchers should consider a multi-faceted approach:

  • X-ray crystallography or cryo-EM for high-resolution structure determination

  • Molecular modeling based on homologous structures of zinc metalloproteases

  • Structure-function analyses through site-directed mutagenesis of conserved residues

  • Inhibitor binding studies to probe active site architecture

Research on ZMPSTE24 demonstrates the value of inhibitor co-crystallization, where a 3.85 Å resolution X-ray crystal structure of a ZMPSTE24–phosphoramidon complex provided insights into binding mode conservation between integral membrane and soluble zinc metalloproteases . Such approaches could reveal whether CPE1693 shares structural features with gluzincins or other zinc metalloprotease subfamilies, informing predictions about its specificity and function.

How does the substrate specificity of CPE1693 compare with other zinc metalloproteases?

While specific data on CPE1693 substrate specificity requires experimental determination, insights can be drawn from other zinc metalloproteases. ZmpB from B. cenocepacia exhibits broad substrate specificity, cleaving α-1 proteinase inhibitor, α2-macroglobulin, type IV collagen, fibronectin, lactoferrin, transferrin, and immunoglobulins .

To characterize CPE1693 substrate specificity, researchers should:

  • Test activity against common zinc metalloprotease substrates

  • Perform detailed kinetic analyses to determine kcat and Km values for different substrates

  • Compare specificity profiles with those of well-characterized zinc metalloproteases

  • Investigate the effects of mutations in key residues on substrate recognition

These analyses will help position CPE1693 within the broader zinc metalloprotease family and provide insights into its potential biological roles.

What is the significance of the preproenzyme structure in zinc metalloproteases like CPE1693?

Many zinc metalloproteases, including ZmpB and ZmpA from B. cenocepacia, are initially expressed as preproenzymes that undergo processing to generate the mature, active enzyme . This processing typically involves autocatalytic cleavage, as seen with ZmpB, which is expressed as a 63-kDa preproenzyme precursor that cleaves into mature ZmpB (35 kDa) and a 27-kDa prepropeptide .

The prepro sequence likely serves several functions:

  • Protecting the producing cell from premature protease activity

  • Assisting in proper folding of the catalytic domain

  • Potentially directing the protein to specific cellular compartments

For CPE1693, researchers should investigate:

  • Whether it is expressed as a preproenzyme

  • The mechanism and timing of processing events

  • The role of the propeptide in regulating activity and folding

Understanding these aspects will provide important insights into CPE1693's maturation pathway and activity regulation.

How does CPE1693 interact with inhibitors, and what does this reveal about its structure?

Understanding inhibitor interactions is crucial for elucidating CPE1693's structure-function relationships. Research on other zinc metalloproteases provides a framework for investigation. For instance, ZMPSTE24 interacts with phosphoramidon in a manner consistent with competitive inhibition, similar to soluble zinc metalloproteases, particularly gluzincins .

To characterize CPE1693-inhibitor interactions, researchers should:

  • Determine IC50 values for common zinc metalloprotease inhibitors (EDTA, 1,10-phenanthroline, phosphoramidon)

  • Perform enzyme kinetics in the presence of inhibitors to establish inhibition mechanisms

  • If possible, obtain co-crystal structures with bound inhibitors

  • Compare inhibition profiles with those of other zinc metalloproteases

These studies will reveal important information about CPE1693's active site architecture and its relationship to other zinc metalloprotease subfamilies.

What are common challenges in obtaining active recombinant CPE1693, and how can they be addressed?

Researchers working with recombinant zinc metalloproteases often encounter several challenges:

  • Expression as inclusion bodies: Modifying expression conditions (lower temperature, reduced inducer concentration) or using solubility-enhancing fusion tags might improve soluble expression.

  • Incomplete processing from preproenzyme: If CPE1693 requires autocatalytic processing like ZmpB , ensuring proper folding conditions and zinc availability during expression and purification may be crucial.

  • Loss of activity during purification: Avoid metal chelators in buffers, and consider adding zinc during purification steps to maintain the integrity of the active site.

  • Proteolytic degradation: Include appropriate protease inhibitors during purification, while avoiding those that might interfere with the zinc-dependent activity.

Systematic optimization of expression and purification protocols, potentially drawing on successful approaches used for similar metalloproteases, can help overcome these challenges.

How should unexpected results in CPE1693 mutagenesis studies be interpreted?

When conducting mutagenesis studies on CPE1693, unexpected results might arise that challenge existing models of zinc metalloprotease function. For interpretation:

  • Compare with similar mutations in related enzymes: Literature on ZmpA, ZmpB, or ZMPSTE24 might provide context for interpreting CPE1693 mutant phenotypes .

  • Consider indirect effects on structure: Mutations might affect protein folding, stability, or zinc coordination indirectly, rather than directly impacting catalysis.

  • Examine multiple parameters: Assess changes in Km, kcat, substrate specificity, and inhibitor sensitivity to build a comprehensive picture of how the mutation affects function.

  • Validate with structural studies: If possible, obtain structural information on the mutant to directly observe conformational changes.

The directed evolution study on the rsep metalloprotease demonstrates how mutations can significantly enhance activity and substrate affinity , highlighting the complex relationship between sequence and function in these enzymes.

What considerations are important when comparing in vitro and in vivo data for CPE1693?

When reconciling in vitro biochemical data with in vivo observations for CPE1693, researchers should consider:

  • Regulatory factors: In vivo expression might be subject to quorum-sensing regulation or other control mechanisms, as seen with ZmpB , affecting when and where the protease is active.

  • Physiological substrates: In vitro substrate preference might not reflect the actual targets in vivo. ZmpB, for example, has activity against multiple substrates in vitro, potentially indicating diverse roles in vivo .

  • Environmental conditions: The enzyme's pH and temperature optima determined in vitro should be considered in the context of its native environment.

  • Protein-protein interactions: Interactions with other cellular components might modulate CPE1693 activity in vivo in ways not captured by in vitro assays.

These considerations are essential for accurately interpreting CPE1693's biological significance and avoiding overinterpretation of in vitro data.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.