Recombinant Putative zinc metalloprotease Rv2625c/MT2700 (Rv2625c, MT2700)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we can prioritize the development of a specific tag if requested. Please communicate your requirements.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
full length protein
Target Names
Rv2625c, MT2700
Target Protein Sequence
MRDAIPLGRIAGFVVNVHWSVLVILWLFTWSLATMLPGTVGGYPAVVYWLLGAGGAVMLL ASLLAHELAHAVVARRAGVSVESVTLWLFGGVTALGGEAKTPKAAFRIAFAGPATSLALS ATFGALAITLAGVRTPAIVISVAWWLATVNLLLGLFNLLPGAPLDGGRLVRAYLWRRHGD SVRAGIGAARAGRVVALVLIALGLAEFVAGGLVGGVWLAFIGWFIFAAAREEETRISTQQ LFAGVRVADAMTAQPHTAPGWINVEDFIQRYVLGERHSAYPVADRDGSITGLVALRQLRD VAPSRRSTTSVGDIALPLHSVPTARPQEPLTALLERMAPLGPRSRALVTEGSAVVGIVTP SDVARLIDVYRLAQPEPTFTTSPQDADRFSDAG
Uniprot No.

Q&A

What is Rv2625c/MT2700 and what organism does it originate from?

Rv2625c/MT2700 is a putative zinc metalloprotease from Mycobacterium tuberculosis. It is a 393-amino acid protein that has been identified as part of transcriptional response studies of M. tuberculosis under varying environmental conditions, particularly oxygen limitation. As indicated by the "putative" designation, its zinc metalloprotease function has been predicted based on sequence analysis but requires further experimental validation to confirm its enzymatic activity and physiological role .

What expression systems are available for producing recombinant Rv2625c/MT2700?

Several expression systems have been documented for the production of recombinant Rv2625c/MT2700:

  • Bacterial expression (E. coli): The most commonly used system, suitable for high-yield production, though proper folding of mycobacterial proteins can be challenging .

  • Yeast expression systems: Offer post-translational modifications that might be important for protein function .

  • Baculovirus expression: Useful for proteins requiring complex eukaryotic processing .

  • Mammalian cell expression: Provides the most native-like post-translational modifications for proteins intended for interaction studies with host factors .

  • Cell-free expression systems: Allow rapid protein production without the constraints of cellular metabolism, particularly useful for difficult-to-express or toxic proteins .

The choice of expression system should be determined by the specific research objectives, required protein yield, and the importance of post-translational modifications for functional studies .

What purification strategies are most effective for recombinant Rv2625c/MT2700?

For recombinant Rv2625c/MT2700, affinity chromatography using His-tag is the predominant purification method. The typical purification workflow includes:

  • Cell lysis: Sonication of bacterial cells in 1x PBS buffer to release recombinant proteins .

  • Ni²⁺-NTA affinity chromatography: His-tagged Rv2625c/MT2700 binds to nickel resin, allowing contaminants to be washed away .

  • Elution and analysis: The protein is eluted using imidazole-containing buffer, and fractions are analyzed by SDS-PAGE to confirm purity .

  • Dialysis and concentration: Purified fractions are pooled, dialyzed to remove imidazole, and concentrated in a storage buffer (typically 10 mM Tris pH 7.4, 100 mM NaCl, and 5% glycerol) .

This approach typically yields protein with ≥85-90% purity as determined by SDS-PAGE, which is suitable for most functional and structural studies .

How should recombinant Rv2625c/MT2700 be stored to maintain stability and activity?

For optimal stability of recombinant Rv2625c/MT2700, the following storage conditions are recommended:

  • Short-term storage (up to one week): Store working aliquots at 4°C in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

  • Long-term storage: Store at -20°C/-80°C in smaller aliquots to avoid repeated freeze-thaw cycles. Addition of glycerol (final concentration 5-50%, with 50% being most common) helps prevent freeze-thaw damage .

  • Lyophilization: For maximum stability, the protein can be lyophilized and stored as powder, which can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL before use .

Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity .

What is the relationship between Rv2625c and the DosR regulon in M. tuberculosis?

Rv2625c shows a complex relationship with the DosR regulon:

  • Expression pattern: Change point analysis reveals that Rv2625c is up-regulated at time point 6 (corresponding to 0.2% dissolved oxygen tension), similar to many DosR-regulated genes .

  • Regulatory mechanism: Unlike most DosR-regulated genes, Rv2625c lacks obvious DosR-binding sites in its promoter region, suggesting its up-regulation under hypoxic conditions might be due to indirect DosR regulatory control rather than direct binding .

  • Temporal response: The expression profile indicates that Rv2625c responds to very low oxygen tension (0.2% DOT) and not minor shifts in oxygen levels, which is characteristic of genes that help M. tuberculosis adapt to hypoxic environments encountered during infection .

This relationship suggests Rv2625c may play a role in M. tuberculosis adaptation to oxygen-limited environments, such as those encountered within granulomas or inside macrophages during infection .

How can researchers design experiments to assess the enzymatic activity of Rv2625c?

To evaluate the putative zinc metalloprotease activity of Rv2625c, researchers should consider the following experimental approach:

  • Substrate identification:

    • Test a panel of known metalloprotease substrates (peptides with fluorogenic or chromogenic groups)

    • Perform proteomics analysis comparing protein profiles in the presence and absence of recombinant Rv2625c

  • Activity assays:

    • Set up reactions containing purified Rv2625c, potential substrates, and cofactors (Zn²⁺, Ca²⁺, Mg²⁺)

    • Include controls with EDTA or other metal chelators to confirm metal-dependent activity

    • Monitor substrate cleavage using spectrophotometric or fluorometric methods

  • Mutagenesis studies:

    • Generate site-directed mutants of predicted catalytic residues

    • Compare activity of wild-type and mutant proteins to validate the catalytic mechanism

  • Physiological relevance:

    • Create knockout or knockdown strains of Rv2625c in M. tuberculosis

    • Assess phenotypic changes under various stress conditions, particularly hypoxia

    • Evaluate protein substrates in mycobacterial lysates using immunoprecipitation followed by mass spectrometry

These approaches would provide comprehensive evidence regarding the enzymatic function of Rv2625c and its potential role in M. tuberculosis physiology and pathogenesis.

What methodologies can be used to study the role of Rv2625c in M. tuberculosis physiology and pathogenesis?

To investigate the role of Rv2625c in M. tuberculosis physiology and pathogenesis, researchers can employ methodologies similar to those used for studying other mycobacterial genes:

  • Gene knockout/knockdown studies:

    • Generate an Rv2625c mutant strain using temperature-sensitive mycobacteriophage methods

    • Confirm replacement of the Rv2625c coding region with a resistance marker using PCR and qPCR with locus-specific primers

    • Create a complemented strain by cloning Rv2625c with its native promoter into an integrative vector (e.g., pMV306K)

  • Stress adaptation experiments:

    • Subject wild-type, mutant, and complemented strains to various stress conditions (hypoxia, oxidative stress, nutrient limitation)

    • Assess bacterial growth, survival, and morphology under these conditions

    • Test drug tolerance by exposing mid-log phase cultures to antibiotics at 10x MIC₉₉ concentration

  • Transcriptional analysis:

    • Perform RNA-seq to identify differentially expressed genes in Rv2625c mutant vs. wild-type strains

    • Validate findings using quantitative PCR with gene-specific primers

    • Normalize expression to housekeeping genes (e.g., sigA)

  • Protein interaction studies:

    • Identify potential binding partners using pull-down assays, yeast two-hybrid screens, or co-immunoprecipitation

    • Validate interactions using techniques such as surface plasmon resonance or microscale thermophoresis

    • Investigate the effects of these interactions on protein function and signaling pathways

These methodologies would provide comprehensive insights into the physiological and pathogenic roles of Rv2625c in M. tuberculosis.

How does Rv2625c compare structurally and functionally to other zinc metalloproteases from pathogenic bacteria?

A comprehensive comparison of Rv2625c with other bacterial zinc metalloproteases would involve:

  • Sequence analysis:

    • Multiple sequence alignment with characterized zinc metalloproteases from other pathogens

    • Identification of conserved catalytic motifs and zinc-binding sites

    • Phylogenetic analysis to establish evolutionary relationships

  • Structural comparison:

    • Homology modeling of Rv2625c based on crystal structures of related metalloproteases

    • Analysis of active site architecture and substrate-binding pockets

    • Prediction of structural features that might confer substrate specificity

  • Functional analysis:

    • Comparison of substrate preferences and catalytic efficiency

    • Evaluation of the role in virulence across different bacterial pathogens

    • Assessment of potential as a drug target based on conservation and essentiality

While Rv2625c is classified as a putative zinc metalloprotease, experimental validation of its enzymatic activity and comparison with well-characterized metalloproteases would provide valuable insights into its biological function and potential as a therapeutic target.

What approaches can be used to investigate the potential role of Rv2625c in host-pathogen interactions during M. tuberculosis infection?

To explore the role of Rv2625c in host-pathogen interactions, researchers should consider:

  • Macrophage infection models:

    • Compare infection kinetics of wild-type, Rv2625c knockout, and complemented strains in human and murine macrophages

    • Assess bacterial survival, replication, and phagosomal maturation

    • Evaluate macrophage responses including cytokine production, autophagy, and cell death pathways

  • Protein localization studies:

    • Determine the subcellular localization of Rv2625c using fluorescent protein fusions or immunoelectron microscopy

    • Investigate whether Rv2625c is secreted or membrane-associated during infection

    • Assess changes in localization under different environmental conditions

  • Host substrate identification:

    • Perform co-immunoprecipitation studies using Rv2625c with host cell lysates

    • Identify potential host protein substrates using mass spectrometry

    • Validate proteolytic activity against candidate substrates in vitro

  • Animal infection models:

    • Compare virulence of wild-type and Rv2625c mutant strains in mouse models of tuberculosis

    • Assess bacterial burden, granuloma formation, and disease progression

    • Evaluate immune responses to infection at different time points

These approaches would provide insights into whether Rv2625c contributes to M. tuberculosis survival within host cells and tissues, potentially revealing new aspects of tuberculosis pathogenesis.

How might Rv2625c contribute to M. tuberculosis adaptation to hypoxic environments, and what techniques can be used to study this?

To investigate the role of Rv2625c in adaptation to hypoxic environments, researchers can employ the following techniques:

  • Controlled oxygen experiments:

    • Use chemostats or microfluidic devices to create precisely controlled oxygen gradients

    • Compare growth and survival of wild-type and Rv2625c mutant strains under defined oxygen tensions

    • Measure expression levels of Rv2625c at different oxygen concentrations using qPCR or reporter gene assays

  • Transcriptional profiling:

    • Perform RNA-seq analysis comparing wild-type and Rv2625c mutant strains under normoxic and hypoxic conditions

    • Identify genes whose expression is altered in the absence of Rv2625c

    • Use change point analysis to determine the oxygen threshold that triggers Rv2625c up-regulation

  • Metabolic studies:

    • Assess metabolic adaptations using isotope-labeled substrates and metabolomics

    • Compare energy metabolism and redox balance in wild-type and mutant strains

    • Investigate potential roles in maintaining ATP levels during oxygen limitation

  • In vitro granuloma models:

    • Utilize in vitro granuloma models that recreate oxygen gradients found in human TB granulomas

    • Compare the distribution and survival of wild-type and Rv2625c mutant bacteria within these structures

    • Assess the impact on granuloma formation and maintenance

Based on existing data, Rv2625c expression is up-regulated at very low oxygen tension (0.2% DOT), suggesting it plays a role in adaptation to the hypoxic conditions encountered by M. tuberculosis during persistent infection .

What are common challenges in obtaining active recombinant Rv2625c/MT2700, and how can they be addressed?

Researchers commonly encounter several challenges when working with recombinant Rv2625c/MT2700:

  • Protein solubility issues:

    • Challenge: Formation of inclusion bodies in E. coli expression systems

    • Solution: Lower induction temperature (16-18°C), reduce IPTG concentration (0.1-0.5 mM), or use solubility-enhancing fusion tags (SUMO, MBP)

  • Protein folding and activity:

    • Challenge: Obtaining correctly folded protein with proper zinc coordination

    • Solution: Supplement expression media and purification buffers with zinc ions (10-100 μM ZnCl₂), use gentle purification conditions, and verify metal content using atomic absorption spectroscopy

  • Stability during storage:

    • Challenge: Loss of activity during storage due to aggregation or proteolysis

    • Solution: Add glycerol (final concentration 5-50%) for freezing, avoid repeated freeze-thaw cycles, and include protease inhibitors during purification

  • Purity assessment:

    • Challenge: Contaminating bacterial proteases affecting activity assays

    • Solution: Use multiple purification steps (ion exchange chromatography after initial Ni²⁺-NTA), verify purity by SDS-PAGE (≥85-90%), and include appropriate controls in activity assays

Addressing these challenges is crucial for obtaining functionally active Rv2625c/MT2700 suitable for downstream applications in structural and functional studies.

How can researchers validate that recombinant Rv2625c exhibits its native structure and function?

To validate that recombinant Rv2625c maintains its native structure and function, researchers should employ multiple complementary approaches:

  • Structural validation:

    • Circular dichroism (CD) spectroscopy to assess secondary structure elements

    • Thermal shift assays to evaluate protein stability and proper folding

    • Limited proteolysis to probe tertiary structure and domain organization

    • Metal content analysis to confirm zinc incorporation using atomic absorption spectroscopy

  • Functional validation:

    • Enzymatic activity assays using generic metalloprotease substrates

    • Comparison of activities between different expression systems (E. coli vs. mycobacterial)

    • Complementation studies in Rv2625c knockout strains to restore wild-type phenotypes

    • Activity correlation with metal ion availability and response to metalloprotease inhibitors

  • Interaction validation:

    • Pull-down assays to confirm binding to known or predicted interaction partners

    • Surface plasmon resonance or isothermal titration calorimetry to measure binding affinities

    • Comparison of interaction profiles between recombinant and native proteins

What are the current knowledge gaps regarding Rv2625c, and what research directions should be prioritized?

Despite the identification of Rv2625c as a gene up-regulated under hypoxic conditions and its classification as a putative zinc metalloprotease, several significant knowledge gaps remain:

  • Enzymatic activity: The metalloprotease activity of Rv2625c has been predicted based on sequence analysis but has not been experimentally confirmed. Identifying its natural substrates and catalytic mechanism should be a high priority .

  • Physiological role: The function of Rv2625c in M. tuberculosis physiology, particularly during hypoxic adaptation and dormancy, remains unclear. Understanding how it contributes to bacterial survival under stress conditions would provide valuable insights into tuberculosis pathogenesis .

  • Regulatory mechanisms: While Rv2625c is up-regulated under low oxygen conditions similar to DosR-regulated genes, it lacks DosR-binding sites in its promoter region, suggesting alternative regulatory mechanisms that need to be elucidated .

  • Structure-function relationships: Structural characterization of Rv2625c would facilitate understanding of its mechanism of action and potential as a drug target.

  • Role in virulence: Whether Rv2625c contributes to M. tuberculosis virulence, immune evasion, or persistence during infection remains to be determined.

Addressing these knowledge gaps through a combination of biochemical, structural, and genetic approaches would significantly advance our understanding of Rv2625c and potentially reveal new aspects of M. tuberculosis pathogenesis and adaptation.

How might insights from Rv2625c research contribute to tuberculosis drug discovery and development?

Research on Rv2625c may contribute to tuberculosis drug discovery in several ways:

  • Novel drug target potential:

    • If Rv2625c is essential for bacterial adaptation to hypoxic conditions found in granulomas, it could represent a target for drugs aimed at eliminating persistent bacteria

    • Metalloproteases are established drug targets in other diseases, with existing chemical scaffolds that could be adapted for Rv2625c inhibition

  • Insights into persistence mechanisms:

    • Understanding how Rv2625c contributes to bacterial survival under stress conditions may reveal broader vulnerability points in M. tuberculosis metabolism

    • This knowledge could inform development of drugs targeting dormant or persister populations that are difficult to eradicate with current antibiotics

  • Biomarker development:

    • If Rv2625c or its substrates are secreted or otherwise accessible, they might serve as biomarkers for monitoring treatment response or disease progression

    • This could facilitate the development of point-of-care diagnostics for tuberculosis management

  • Combination therapy approaches:

    • Understanding the role of Rv2625c in stress responses might reveal synergistic drug combinations that prevent adaptation to hostile host environments

    • This could lead to more effective treatment regimens with reduced duration

Future research should emphasize validation of Rv2625c as a potential drug target through comprehensive genetic and biochemical characterization, followed by high-throughput screening for inhibitors if it proves to be a promising candidate.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.