Recombinant Putative zinc metalloprotease XF_1047 (XF_1047)

Shipped with Ice Packs
In Stock

Description

Introduction to Zinc Metalloproteases

Zinc metalloproteases are a class of enzymes characterized by their reliance on zinc ions for catalytic activity. These enzymes are critical in diverse biological processes, including protein processing, tissue remodeling, and pathogen virulence. While the query focuses on XF_1047, this compound is not explicitly mentioned in the provided research sources. Below is a synthesized analysis of zinc metalloproteases from the literature, highlighting structural, functional, and research findings relevant to understanding such enzymes.

Functional Roles in Pathogenicity

Zinc metalloproteases are integral to bacterial virulence:

PathogenEnzymeRole in DiseaseExperimental Evidence
Mycobacterium tuberculosisZmp1Induces necrotic cell death; promotes chemokine release and bacterial disseminationHigh concentrations of Zmp1 caused 75.5% necrosis in THP-1 cells; zebrafish models showed dissemination .
Clostridium perfringensZmpA/ZmpBDegrades mucins; reduces virulence in poultry modelszmpA–zmpB double mutants showed reduced necrotic enteritis severity .
Salmonella entericaGtgAInhibits NF-κB signaling; suppresses pro-inflammatory responsesCleavage of p65 and cRel subunits confirmed via mutational analysis .

Research Gaps and Future Directions

The absence of XF_1047 in the literature suggests it may represent a novel or understudied zinc metalloprotease. Key areas for investigation include:

  1. Structural Characterization: Determining whether XF_1047 adopts a Ste24p-like α-barrel or a traditional soluble metalloprotease fold.

  2. Substrate Specificity: Identifying physiological targets (e.g., host proteins, bacterial virulence factors) using approaches like FRET assays or zymography.

  3. Pathogenic Potential: Assessing roles in infection models (e.g., zebrafish, murine) to evaluate virulence contributions.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
XF_1047; Putative zinc metalloprotease XF_1047
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
full length protein
Species
Xylella fastidiosa (strain 9a5c)
Target Names
XF_1047
Target Protein Sequence
MGDFFASIWWMIVSFSVLVTFHEFGHYWVARRCGVKVLRFSIGFGTPLWSRRSSSGTEFV IGAIPLGGYVKMLDEREADVTVAERNQAFNRKSVWQRIAIVAAGPLANLLLCMLLLWVLF VIGKQDYSATVGRAEHLAAQAGIHPGDRITAIDGRQVTSWSEASMLLTAAAMDRQNAVLR VIGPYGERSEHTLELSKLKQPFDERHVTALVGINWQFMLQPPIIAKIEPGSIAEGAIKPG DIVLAVDGQQTLSTEDLYNQIQKLGRDGHPGMIEIRRGEERLALELSPRKSAQGVWLLGV KTNPGPVPAFDSQQRYGVLAAVPLAIRETGRMTADSLGMMKRIITGQASAKNISGPISIA KIANASAKRGVGWFIYFLSLLSLSLAIINLFPIPILDGGHLLYYAIELLKGSPLSTRAMA AGQYIGLALLAGLMGLAFYNDLLG
Uniprot No.

Target Background

Database Links

KEGG: xfa:XF_1047

STRING: 160492.XF1047

Protein Families
Peptidase M50B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is XF_1047 and what organism does it come from?

XF_1047 is a putative zinc metalloprotease encoded by the XF_1047 gene in Xylella fastidiosa, a gram-negative bacterium that causes devastating plant diseases, including citrus variegated chlorosis in citrus and Pierce's disease in grapevines . The protein consists of 444 amino acids and has a molecular weight of approximately 47.2 kDa . The gene has been identified in the complete genome sequence of X. fastidiosa strain 9a5c, and the protein has been annotated as a putative zinc metalloprotease based on sequence homology and structural predictions .

How is recombinant XF_1047 typically expressed and purified?

Recombinant XF_1047, based on current literature, is typically expressed in E. coli expression systems. The protein is commonly produced with an N-terminal 10xHis-tag to facilitate purification using affinity chromatography . According to product specifications, the recombinant protein can be provided in either liquid form or as a lyophilized powder. The recommended storage buffer is a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 .

The purification process typically involves:

  • Expression in E. coli strains optimized for recombinant protein production

  • Cell lysis to release the intracellular protein

  • Immobilized metal affinity chromatography (IMAC) using the His-tag

  • Buffer exchange and concentration steps

  • Quality control by SDS-PAGE to verify purity (>90% purity is typically achieved)

What expression systems are used for studying native XF_1047 in X. fastidiosa?

For studying native XF_1047 expression in X. fastidiosa, researchers typically culture the bacteria in specialized media such as BCYE (Buffered Charcoal Yeast Extract) at 28°C . Gene expression analysis commonly employs:

  • Microarray analysis: Custom microarrays constructed with PCR-amplified ORFs from the complete genome of X. fastidiosa have been used to study differential gene expression under various conditions .

  • RT-qPCR (Reverse Transcription Quantitative PCR): This method is often used to validate microarray results and for more precise quantification of gene expression levels .

  • RNA extraction protocols specifically optimized for X. fastidiosa, which can be challenging due to the bacterium's fastidious nature and biofilm formation tendencies .

The housekeeping gene NuoA (XF0305), which encodes NADH-ubiquinone oxidoreductase, is commonly used as an endogenous control for normalization in gene expression studies .

What is the role of XF_1047 in X. fastidiosa virulence and pathogenicity?

While the exact contribution of XF_1047 to X. fastidiosa pathogenicity has not been fully elucidated, several lines of evidence suggest potential roles in virulence:

  • As a putative zinc metalloprotease, XF_1047 may be involved in protein degradation pathways that affect host-pathogen interactions .

  • Gene expression studies have shown differential expression of XF_1047 under various conditions, with a LogFC value of -2.05 reported in comparative studies . This suggests regulation in response to environmental factors that may influence virulence.

  • X. fastidiosa pathogenicity primarily involves biofilm formation leading to xylem vessel occlusion . Proteases often play roles in biofilm formation and regulation, suggesting a potential function for XF_1047 in this process.

To definitively establish the role of XF_1047 in pathogenicity, researchers should consider:

  • Creating knockout mutants and performing complementation studies

  • Assessing virulence in planta with mutant strains

  • Analyzing biofilm formation capabilities in the absence of functional XF_1047

  • Studying protein-protein interactions between XF_1047 and host targets

How does XF_1047 relate to other regulatory systems in X. fastidiosa?

Research suggests potential connections between XF_1047 and other regulatory systems in X. fastidiosa:

  • The RpoE (σE) system: Research has demonstrated that an rpoE null mutant in X. fastidiosa showed sensitivity to environmental stressors like heat shock and ethanol exposure . Microarray analysis revealed that genes in the RpoE regulon showed differential expression under stress conditions.

  • Potential connection to two-component regulatory systems: Gene expression data indicates that the XF2534 gene, which encodes a two-component system regulatory protein, shows differential expression (-1.62 LogFC) under certain conditions, potentially linking XF_1047 to broader regulatory networks .

Research on the XF_1047 regulatory context should include:

  • Promoter analysis to identify binding sites for known transcription factors

  • Chromatin immunoprecipitation (ChIP) studies to identify protein-DNA interactions

  • Transcriptome analysis comparing wild-type and regulatory mutants

  • Analysis of potential post-translational regulation of XF_1047 activity

How can experimental design help resolve contradictory data about XF_1047 expression and function?

When faced with contradictory data about XF_1047, researchers should implement robust experimental design principles based on established methodologies :

  • Control experimental variables rigorously:

    • Standardize growth conditions (media composition, temperature, pH)

    • Use defined growth phases for all experiments

    • Document all experimental parameters completely

  • Implement multi-method validation:

    • Combine transcriptomics (microarray, RNA-seq) with proteomics approaches

    • Validate RNA expression data with RT-qPCR

    • Confirm protein activity with multiple biochemical assays

  • Analyze context-dependent expression:

    • Compare in vitro expression with in vivo expression in plant hosts

    • Examine expression in different X. fastidiosa strains with varying virulence

    • Study expression under different stress conditions

  • Apply statistical rigor:

    • Use appropriate statistical tests for data analysis

    • Perform power analysis to determine adequate sample sizes

    • Implement multiple testing corrections when analyzing high-throughput data

  • Design specialized experiments to address contradictions:

    • Apply the quasi-experimental design approach described by Campbell and Stanley

    • Implement time-series experiments to capture dynamic regulation

    • Use equivalent materials design when comparing different expression systems

What analytical techniques are most appropriate for studying XF_1047 activity?

For comprehensive characterization of XF_1047 activity, researchers should consider multiple analytical approaches:

In vitro biochemical characterization:

  • Protease activity assays with fluorogenic or chromogenic substrates

  • Zymography to detect proteolytic activity in polyacrylamide gels

  • Metal dependency studies using chelators and reconstitution experiments

  • Substrate specificity analysis using peptide libraries

  • Kinetic studies to determine catalytic parameters (Km, kcat, Vmax)

Structural biology approaches:

  • X-ray crystallography or cryo-electron microscopy for atomic-level structure

  • Circular dichroism spectroscopy for secondary structure analysis

  • Mass spectrometry for protein-protein interaction studies

  • Hydrogen-deuterium exchange mass spectrometry for dynamics analysis

Cellular and in vivo approaches:

  • Localization studies using fluorescently tagged XF_1047

  • Biofilm formation assays with wild-type and mutant strains

  • Plant infection studies comparing mutant and complemented strains

  • Transcriptomics and proteomics to identify downstream effects of XF_1047 activity

How can researchers identify and address contradictions in XF_1047 research data?

Identifying and resolving contradictions in research data is crucial for advancing our understanding of XF_1047. Based on methodological approaches described in the literature , researchers should:

  • Systematically catalog contradictions:

    • Review published literature to identify contradictory findings

    • Classify contradictions using the (α, β, θ) notation system

    • Create data visualization tools like those described for "ConTra"

  • Analyze potential sources of contradiction:

    • Experimental condition differences (temperature, media, strain)

    • Methodological variations in protein expression and purification

    • Different assay systems for activity measurement

    • Biological context variations (in vitro vs. in planta)

  • Apply mutual exclusion rules to identify true contradictions:

    • Distinguish between incomplete context (e.g., different strains) and true contradictions

    • Apply Boolean minimization techniques to complex contradiction patterns

  • Design targeted experiments to resolve contradictions:

    • Directly test competing hypotheses in parallel experiments

    • Systematically vary experimental parameters to identify critical factors

    • Implement multi-laboratory validation for controversial findings

A sample analysis framework for contradictions in XF_1047 data might include:

  • Cataloging contradictory findings in a structured database

  • Analyzing experimental conditions for each study

  • Mapping contradictions to specific experimental variables

  • Designing experiments that specifically address the identified contradictions

What data on gene expression patterns of XF_1047 exists across different conditions?

Gene expression analysis has revealed differential expression of XF_1047 under various conditions. Based on the available literature, we can summarize the expression data as follows:

Gene IDLogFCFunctional CategoryProduct Description
XF1047-2.05VIII.AConserved hypothetical protein (47.2 kDa)

This indicates downregulation (negative LogFC value) under the experimental conditions tested . For context, several other genes showed differential expression in the same study, including:

  • XF0311 (NADH-ubiquinone oxidoreductase): LogFC -5.73

  • XF1626 (two-component system regulatory protein): LogFC -5.55

  • XF0846 (beta-mannosidase precursor): LogFC -4.16

  • XF0912 (stringent starvation protein B): LogFC -3.69

These expression patterns suggest that XF_1047 may be co-regulated with genes involved in energy metabolism, stress response, and two-component signaling systems.

For comprehensive understanding of XF_1047 expression, researchers should:

  • Perform RNA-seq analysis under additional environmental conditions

  • Examine expression in different plant hosts and artificial media

  • Study temporal expression patterns during infection progression

  • Analyze promoter activity using reporter constructs

What resources are available for studying XF_1047?

Researchers interested in studying XF_1047 can access several resources:

  • Protein resources:

    • Recombinant full-length protein (1-444aa) with N-terminal His-tag expressed in E. coli

    • UniProt entry: Q9PEI1

    • Protein available in both liquid and lyophilized forms

  • Genetic resources:

    • Complete genome sequence of X. fastidiosa strains

    • Gene expression data from microarray studies

    • Potential knockout mutants described in literature

  • Bioinformatic resources:

    • Xylella fastidiosa Genome Project database (http://aeg.lbi.ic.unicamp.br/xf/)[10]

    • SemMedDB for relation extraction and literature mining

    • Sequence analysis tools for predicting functional domains

  • Methodological resources:

    • Protocols for X. fastidiosa culture and genetic manipulation

    • RNA extraction and gene expression analysis methods

    • Microarray data analysis pipelines using R and Bioconductor packages

What experimental design approaches are most effective for studying XF_1047 in vivo?

For in vivo studies of XF_1047, effective experimental design approaches include:

  • Plant infection models:

    • Use of both susceptible (e.g., Pera variety citrus) and resistant/tolerant (e.g., Navelina ISA 315) plant varieties

    • Controlled inoculation techniques to ensure reproducible infection

    • Collection of samples at multiple time points post-infection

    • Use of micrografting techniques to produce healthy control plants

  • RNA extraction and analysis:

    • Collection of plant material from multiple individual plants to minimize variability

    • Extraction of total RNA from both symptomatic and asymptomatic leaves

    • Use of appropriate endogenous controls for normalization (e.g., NuoA gene)

    • Validation of microarray results using RT-qPCR

  • Comparative analysis frameworks:

    • Between-subjects design comparing wild-type and mutant strains

    • Within-subjects design comparing expression across time points

    • Control of extraneous variables that might influence results

    • Systematic variation of independent variables (temperature, nutrients, etc.)

  • Statistical considerations:

    • Use of appropriate statistical methods for data analysis (e.g., limma package)

    • Normalization to account for technical variation

    • Application of multiple testing corrections

    • Documentation of all experimental parameters to enable reproducibility

By implementing these rigorous experimental design approaches, researchers can generate reliable data on XF_1047 function in vivo, helping to resolve contradictions and advance our understanding of this putative zinc metalloprotease's role in X. fastidiosa biology and pathogenicity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.