Recombinant Pygathrix bieti C-C chemokine receptor type 5 (CCR5)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant Pygathrix bieti CCR5 is typically produced in E. coli systems for cost-effectiveness and scalability .

ParameterDetails
Expression HostEscherichia coli (E. coli)
TagN-terminal His-tag
Purity>90% (verified by SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with 50% glycerol for stability

Role in HIV-1 Entry

  • CCR5 serves as a co-receptor for R5-tropic HIV-1 strains, enabling viral fusion with host cells .

  • Structural studies show that the N-terminus and ECL2 interact with HIV-1 gp120, analogous to human CCR5 .

Chemokine Signaling

  • Binds ligands like CCL3, CCL4, and CCL5, activating G protein-dependent pathways (e.g., MAPK/ERK) and β-arrestin-mediated internalization .

  • Agonist binding induces receptor trafficking to lysosomes or Golgi, influencing immune cell migration and inflammation .

HIV-1 Resistance Studies

  • Used to screen inhibitors (e.g., maraviroc) that block HIV-1 entry by occupying the gp120-binding pocket .

  • Gene-editing studies (e.g., CRISPR-Cas9) utilize recombinant CCR5 to model Δ32-like mutations that confer resistance .

Immune Regulation

  • Investigated in models of Leishmania infection, where CCR5 deficiency enhances effector T cell responses and pathogen clearance .

Comparative Analysis

FeaturePygathrix bieti CCR5Human CCR5
Amino Acid Length352352
HIV-1 Co-receptorFunctional (R5-tropic strains)Functional (R5-tropic strains)
Δ32 MutationNot observedConfers HIV resistance
Expression SystemE. coliMammalian cells (common)

Challenges and Innovations

  • Low Yield in E. coli: Optimized codon usage and refolding protocols improve soluble protein recovery .

  • Ligand-Specific Trafficking: Recent studies show chemokine agonists like CCL5 induce distinct CCR5 endocytosis patterns, informing drug design .

Future Directions

  • Therapeutic Development: Engineered CCR5 variants could enhance gene therapy for HIV-1 .

  • Cancer Research: CCR5 inhibition reduces metastasis in triple-negative breast cancer models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be selected during the production process. If you have a preferred tag type, please inform us, and we will prioritize its inclusion in the manufacturing process.
Synonyms
CCR5; CMKBR5; C-C chemokine receptor type 5; C-C CKR-5; CC-CKR-5; CCR-5; CCR5; CD antigen CD195
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-352
Protein Length
full length protein
Species
Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)
Target Names
Target Protein Sequence
MDYQVSSPTYDIDYYTSEPCQKVNVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCYIFQQEAPERASSVYTRSTGEQEISVGL
Uniprot No.

Target Background

Function
CCR5 serves as a receptor for a number of inflammatory CC-chemokines, including CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES. Upon binding these chemokines, CCR5 initiates intracellular signaling by increasing calcium ion levels. This receptor potentially plays a role in regulating the proliferation and differentiation of granulocytic lineage cells. CCR5 participates in T-lymphocyte migration to infection sites by acting as a chemotactic receptor.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of CCR5 and how does it compare between Pygathrix bieti and human variants?

CCR5 (C-C chemokine receptor type 5) is a G protein-coupled receptor composed of 352 amino acid residues with a molecular weight of approximately 40.6kDa. Its structural elements include an extracellular N-terminus, three extracellular loops (EL1, EL2, EL3), three intracellular loops (IL1, IL2, IL3), seven transmembrane α-helices, and an intracellular C-terminus .

The Pygathrix bieti CCR5 sequence shares high homology with human CCR5, though with specific amino acid differences that may affect ligand binding properties. Alignment analysis shows key differences in the N-terminal domain and extracellular loops that could influence chemokine recognition. The full amino acid sequence of Pygathrix bieti CCR5 (UniProt O97880) is available and can be compared with the human variant for structure-function relationship studies .

What cellular expression patterns are characteristic of CCR5 and how might they differ in Pygathrix bieti?

In humans, CCR5 is primarily expressed on immune cells, including memory resting T lymphocytes, monocytes, and immature dendritic cells. This expression pattern mediates its role in regulating immune cell migration, proliferation, and immune response . While specific expression data for Pygathrix bieti is limited, primate CCR5 expression generally follows similar patterns to humans, though species-specific differences in expression levels and tissue distribution may exist. These differences could potentially influence immune responses and susceptibility to certain infections, making comparative expression studies valuable for understanding both basic biology and disease mechanisms.

What expression systems are most effective for producing functional recombinant Pygathrix bieti CCR5?

  • Use of specialized E. coli strains such as Origami 2(DE3) that facilitate proper disulfide bond formation

  • Optimization of induction conditions (temperature, IPTG concentration, and induction time)

  • Addition of solubility-enhancing fusion tags, particularly His-tags for purification purposes

  • Careful consideration of codon optimization for the E. coli expression system

It's worth noting that for functional studies requiring post-translational modifications, mammalian or insect cell expression systems might yield more native-like protein, though with potentially lower yields .

What purification strategies maximize yield and maintain functionality of recombinant CCR5 proteins?

Effective purification of recombinant CCR5 typically employs immobilized metal ion affinity chromatography (IMAC) when the protein contains a His-tag . A methodological approach should include:

  • Initial clarification of cell lysates via centrifugation (15,000g for 30 minutes)

  • Solubilization of membrane-associated proteins using mild detergents (DDM or CHAPS at 1-2%)

  • IMAC purification using Ni-NTA or Co-NTA resins with imidazole gradient elution

  • Secondary purification via size exclusion chromatography to enhance purity

  • Buffer optimization to maintain protein stability (typically Tris-based buffers with 50% glycerol)

For Pygathrix bieti CCR5, researchers should monitor protein quality throughout purification using SDS-PAGE and Western blotting with anti-His antibodies or specific anti-CCR5 antibodies to confirm identity and integrity.

How can researchers confirm the structural integrity and functionality of purified recombinant Pygathrix bieti CCR5?

Multiple complementary approaches should be employed to validate recombinant CCR5 proteins:

Validation MethodTechnical ApproachExpected Outcome
Immunoblot analysisSDS-PAGE followed by Western blotting with anti-CCR5 or anti-tag antibodiesSingle band at ~40-45 kDa
ImmunoprecipitationPull-down with specific antibodies followed by detectionSpecific recovery of CCR5 protein
ELISADirect or sandwich ELISA using specific antibodiesConcentration-dependent signal
Circular dichroismFar-UV spectroscopyCharacteristic α-helical spectrum typical of GPCRs
Binding assaysInteraction with known CCR5 ligands (MIP-1α, MIP-1β, RANTES)Specific binding with nanomolar affinity

Research shows that functional recombinant CCR5 proteins bind to specific anti-CCR5 antibodies in immunoblot, immunoprecipitation, and ELISA assays, confirming proper folding and epitope presentation . For Pygathrix bieti CCR5, cross-reactivity with human CCR5 antibodies should be tested, as epitope conservation may vary.

What are the optimal storage conditions for maintaining stability of recombinant Pygathrix bieti CCR5?

Based on available data for recombinant CCR5 proteins, including Pygathrix bieti CCR5, the following storage recommendations are supported:

  • Short-term storage (up to one week): 4°C in appropriate buffer

  • Medium-term storage: -20°C in buffer containing 50% glycerol

  • Long-term storage: -80°C in small aliquots to avoid repeated freeze-thaw cycles

The optimal buffer composition typically includes:

  • Tris-based buffer (pH 7.4-8.0)

  • 50% glycerol as cryoprotectant

  • 1mM DTT to prevent oxidation

  • Protease inhibitors to prevent degradation

  • In some cases, specific stabilizers like trehalose (5%)

Accelerated thermal degradation tests indicate that properly stored recombinant CCR5 proteins show less than 5% degradation when maintained under these conditions .

How can recombinant Pygathrix bieti CCR5 be utilized for comparative studies with human CCR5 in HIV research?

Recombinant Pygathrix bieti CCR5 offers valuable opportunities for comparative studies with human CCR5 in HIV research. The methodological approach should include:

  • Binding studies to compare interaction kinetics with HIV gp120 between human and Pygathrix bieti CCR5

  • Analysis of structural differences in the binding domains, particularly the N-terminus and second extracellular loop which are crucial for HIV-1 interaction

  • Mutation studies to identify species-specific amino acids that affect HIV binding

  • Development of competitive inhibition assays using both protein variants to screen potential HIV entry inhibitors

These comparative studies can provide insights into structural determinants of HIV susceptibility, as non-human primates show variable susceptibility to HIV-1 infection. The recombinant proteins can be used to establish competitive ELISA assays for screening combinative drug libraries to identify potential inhibitors that may have therapeutic value .

What technical approaches can resolve contradictory findings when comparing CCR5 function across different primate species?

When faced with contradictory results in cross-species CCR5 functional studies, researchers should implement a systematic troubleshooting approach:

  • Protein quality assessment: Validate that all recombinant proteins meet similar quality criteria (purity >90%, correct folding confirmed by CD spectroscopy)

  • Standardization of experimental conditions: Use identical buffer conditions, temperature, and incubation times across experiments

  • Parallel testing: Perform side-by-side experiments with multiple species variants under identical conditions

  • Multiple detection methods: Implement orthogonal assays to confirm results (e.g., ELISA, surface plasmon resonance, and cell-based assays)

  • Sequence-structure analysis: Conduct detailed comparative analysis of amino acid differences that might explain functional differences

For Pygathrix bieti CCR5 specifically, researchers should focus on differences in the extracellular domains and transmembrane regions that might affect ligand recognition and signaling properties when comparing to human or other primate CCR5 variants .

How can researchers design assays using recombinant Pygathrix bieti CCR5 for screening potential HIV-1 inhibitors?

Developing robust screening assays using recombinant Pygathrix bieti CCR5 requires careful methodological design:

  • Competitive ELISA assay development:

    • Immobilize recombinant CCR5 at optimal concentration (typically 10 μg/ml)

    • Establish standard curves with known CCR5 ligands or antibodies

    • Validate assay parameters (Z' factor >0.5, signal-to-noise ratio >10)

    • Implement high-throughput format for screening compound libraries

  • Binding inhibition studies:

    • Establish EC50 values for reference compounds (1-2 ng/mL range for antibodies)

    • Use appropriate negative controls (unrelated proteins with similar tags)

    • Include species-comparative analysis with human CCR5 in parallel

  • Data analysis approaches:

    • Apply dose-response curve fitting (four-parameter logistic model)

    • Implement counter-screening to eliminate false positives

    • Validate hits with orthogonal binding assays

This methodological framework allows for the identification of compounds that specifically inhibit CCR5-mediated interactions, potentially leading to novel HIV-1 entry inhibitors or modulators of inflammatory responses .

What insights can comparative studies between CCR5Δ32 mutation and recombinant Pygathrix bieti CCR5 provide for therapeutic development?

Comparative analysis between human CCR5Δ32 mutation effects and Pygathrix bieti CCR5 function can yield valuable therapeutic insights:

  • Structural basis of resistance:

    • The CCR5Δ32 mutation in humans impairs CCR5 expression on the cell surface and provides protection against HIV infection in homozygous individuals

    • Engineering analogous mutations in Pygathrix bieti CCR5 can identify conserved structural elements required for membrane expression and function

  • Methodological approach for comparative studies:

    • Generate recombinant proteins representing both wild-type and modified versions

    • Perform detailed binding studies with chemokines and viral envelope proteins

    • Conduct molecular dynamics simulations to understand conformational changes

    • Analyze effects on signaling pathways using reconstituted systems

  • Therapeutic implications:

    • CCR5 antagonists aim to mimic the natural effects of CCR5Δ32 in humans

    • Understanding primate CCR5 variants can help develop more specific modulators

    • Comparative studies may reveal novel binding sites or regulatory mechanisms

These studies could contribute to the development of CCR5 modulators with applications beyond HIV infection, including inflammatory diseases and other viral infections where CCR5 plays a role .

What are the key considerations for researchers designing experiments with recombinant Pygathrix bieti CCR5?

When working with recombinant Pygathrix bieti CCR5, researchers should consider:

  • Expression system selection: While E. coli systems are commonly used, they may not reproduce all post-translational modifications. Consider the specific research questions when selecting between prokaryotic and eukaryotic expression systems.

  • Protein quality assessment: Implement rigorous quality control measures to ensure proper folding and functionality, including multiple validation techniques.

  • Comparative context: Include human CCR5 controls in experiments to establish relevant comparative data and highlight species-specific differences.

  • Application-specific optimization: For binding studies, inhibitor screening, or structural analysis, optimize buffer conditions and experimental parameters specific to each application.

  • Storage and handling: Follow recommendations for proper storage to maintain protein stability and functionality over time.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.