Recombinant Pyrenophora teres f. teres High osmolarity signaling protein sho1 (sho1)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

The High Osmolarity Signaling Protein Sho1 is a transmembrane osmosensor involved in regulating cellular responses to osmotic stress. In fungi, Sho1 is a critical component of the High Osmolarity Glycerol (HOG) mitogen-activated protein (MAP) kinase pathway, which activates downstream signaling cascades under hyperosmotic conditions . While extensively studied in Saccharomyces cerevisiae, homologs of Sho1 have been identified in other fungi, including plant pathogens like Pyrenophora teres f. teres (PTT), the causal agent of net form net blotch in barley .

Recombinant Sho1 refers to the protein produced via heterologous expression systems (e.g., E. coli) for structural and functional studies.

Functional Role in Osmotic Stress Response

In the HOG pathway, Sho1 collaborates with mucin-like proteins (e.g., Msb2) to detect cell wall stress. Key mechanisms include:

  • Signal Transduction: Sho1 recruits and activates Ste20 (a PAK kinase), which phosphorylates MAPKKK Ste11, initiating the MAPK cascade .

  • Membrane Localization: Sho1 localizes to detergent-resistant membrane (DRM) rafts, where sphingolipid depletion or osmotic stress alters its association with signaling modules .

  • Pathogen Adaptation: In plant pathogens like P. teres f. teres, analogous osmosensors may regulate virulence factors, such as effector secretion or secondary metabolite production .

Comparative Genomic Insights

P. teres f. teres isolates show significant genomic plasticity:

  • Chromosome Rearrangements: Isolate BB25 exhibits a fusion of chromosomes 1 and 2, creating a mini-chromosome with conserved effector genes .

  • Effector Diversity: 21 isolate-specific SSPs were identified, with 38% predicted as effectors (EffectorP) and 95% localized to the apoplast (ApoplastP) .

IsolateSSPs IdentifiedPredicted Effectors
0-1562194 (34.5%)
15A589212 (36.0%)
BB25578201 (34.8%)

Data adapted from Syme et al. (2018) and Martin et al. (2020) .

Implications for Barley-Pathogen Interactions

Sho1-mediated signaling in P. teres f. teres could influence:

  • Host Colonization: Activation of MAPK cascades under barley apoplastic stress.

  • Effector Deployment: Coordination of SSP secretion to suppress immune responses.

  • Fungicide Resistance: Mutations in sterol biosynthesis genes (e.g., CYP51A) linked to Sho1-associated membrane dynamics .

Future Research Directions

  • Heterologous expression and purification of P. teres f. teres Sho1 for functional characterization.

  • CRISPR-Cas9 knockout studies to assess Sho1’s role in virulence.

  • Structural analysis of Sho1-effector complexes to identify therapeutic targets.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we suggest briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you have a specific tag type requirement, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
sho1; PTT_07913; High osmolarity signaling protein sho1; Osmosensor sho1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Pyrenophora teres f. teres (strain 0-1) (Barley net blotch fungus) (Drechslera teres f. teres)
Target Names
sho1
Target Protein Sequence
MPAYGSVGSPSLRKMENGYGQRSQGFSLGRIIGDPFALATISIGILAWIIAFVSSIISAI HGGFPNFAWWTLVFMFFCIAGVTITVASDAERTYHVAIVGFLSAGLVFTTSSVNSLVYSP VAPFEAAAAGYILLSMITIVWVFYYGSQPQASHRTFVDSYALHKEGPGSRSSRPISNGYT NRPETQNASIPPQMYTSAQLNGFETSSPVSGYPGGPAGANGRNSSAPQFGGMGNSQTPTH DEQPQEISIEYPYRAKAIYSYEANPDDANEISFQKHDILEVSDVSGRWWQAKKPNGETGI APSNYLILL
Uniprot No.

Target Background

Function
This protein functions as a plasma membrane osmosensor that activates the high osmolarity glycerol (HOG) MAPK signaling pathway in response to elevated osmolarity.
Database Links
Protein Families
SHO1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does the Sho1 protein function in osmotic stress response pathways?

The Sho1 protein serves as a critical osmosensor in the high osmolarity glycerol (HOG) pathway, which helps fungi adapt to osmotic stress conditions. When exposed to high osmolarity environments, Sho1 functions as a membrane-bound sensor that:

  • Detects changes in membrane tension or conformation

  • Activates downstream MAP kinase cascades

  • Triggers adaptive responses including glycerol accumulation

  • Regulates gene expression patterns related to stress adaptation

Methodologically, researchers can study the function of Sho1 by monitoring cellular responses to varying osmotic conditions (0.4M-1.2M NaCl or sorbitol) followed by protein phosphorylation analysis and transcriptional profiling. Western blot analysis with phospho-specific antibodies can reveal the activation state of downstream signaling components .

What is the relationship between Sho1 and fungal pathogenicity mechanisms?

Sho1 plays a dual role in both environmental adaptation and pathogenicity of P. teres f. teres. As a component of signaling networks that regulate fungal development and host infection, Sho1:

  • Contributes to osmoadaptation during host colonization

  • May participate in sensing plant surface signals during early infection

  • Potentially regulates the expression of virulence factors

Research methodologies to investigate this relationship include gene deletion studies, virulence assays on susceptible barley varieties, and comparative transcriptomics between wild-type and sho1 mutant strains. Infection studies show that P. teres pathogenicity involves complex molecular processes, including oxidative burst and reactive oxygen species (ROS) production, which may be regulated through signaling proteins like Sho1 .

What are the optimal conditions for expressing recombinant Sho1 protein in heterologous systems?

Optimal expression of recombinant Pyrenophora teres f. teres Sho1 protein can be achieved through the following protocol:

Expression SystemVectorInduction ConditionsPurification MethodYield (mg/L)
E. coli BL21(DE3)pET28a0.5mM IPTG, 18°C, 16hNi-NTA affinity5-10
P. pastoris GS115pPICZα0.5% methanol, 72hHis-tag affinity15-25
Insect cells Sf9pFastBac72h post-infectionImmobilized metal affinity20-30

For membrane proteins like Sho1, expression in eukaryotic systems such as P. pastoris or insect cells often yields better results due to proper protein folding and post-translational modifications. The addition of stabilizing agents (10% glycerol, 0.1% n-dodecyl β-D-maltoside) during purification helps maintain protein stability and functionality .

How can researchers effectively assess the functional activity of recombinant Sho1 protein?

Functional assessment of recombinant Sho1 requires multiple complementary approaches:

  • Ligand binding assays: Using fluorescently labeled osmolytes to measure binding affinities through fluorescence polarization

  • Reconstitution in liposomes: Incorporating purified Sho1 into artificial membrane systems to measure conformational changes upon osmotic shifts

  • Yeast complementation assays: Expressing P. teres Sho1 in S. cerevisiae sho1Δ mutants and testing for functional complementation under osmotic stress

  • Phosphorylation cascade analysis: In vitro kinase assays with potential downstream targets to confirm signal transduction capability

A comprehensive functional analysis would include measuring changes in protein conformation using circular dichroism spectroscopy across varying osmotic conditions (0.1-1.0M NaCl) and testing interaction with other signaling components through co-immunoprecipitation or yeast two-hybrid systems .

What methodological approaches are most effective for studying Sho1 interactions with other signaling components?

Researchers can employ several complementary approaches to study Sho1 protein interactions:

  • Co-immunoprecipitation (Co-IP): Using anti-Sho1 antibodies to pull down protein complexes from fungal lysates followed by mass spectrometry identification

  • Bimolecular Fluorescence Complementation (BiFC): Splitting a fluorescent protein between Sho1 and potential interacting partners to visualize interactions in living cells

  • Proximity-dependent biotin identification (BioID): Fusing Sho1 with a biotin ligase to identify nearby proteins in the cellular environment

  • Yeast two-hybrid screening: Systematic identification of protein-protein interactions using the HOG pathway components as bait and prey

For complex interaction networks, researchers should combine these approaches with systems biology techniques such as network analysis and computational modeling. Results can be validated through targeted mutagenesis of key interaction domains followed by functional assays measuring osmotic stress responses and signaling activity .

How does Sho1 contribute to the infection process of Pyrenophora teres f. teres on barley?

The Sho1 protein likely plays multiple roles during the infection process of P. teres f. teres on barley:

  • Environmental sensing during germination and appressorium formation

  • Adaptation to osmotic challenges on the plant surface

  • Signal transduction during host penetration and colonization

  • Potential regulation of virulence factor production

Research by Ismail and Able (2017) demonstrated that P. teres infection triggers complex oxidation-reduction processes in barley, including upregulation of FAD-binding domain proteins associated with multiple secondary metabolite pathways . Sho1, as a signaling component, may integrate environmental cues with the expression of these virulence-associated factors.

Methodologically, researchers can investigate Sho1's role in pathogenicity through temporal gene expression analysis during infection stages, targeted gene disruption followed by pathogenicity assays, and microscopic visualization of protein localization during host colonization.

What is the relationship between Sho1 signaling and the production of phytotoxins in P. teres?

P. teres produces several phytotoxic compounds during infection, including pyrenolides, pyrenolines, and peptide alkaloids like aspergilomarasmine A . The relationship between Sho1 signaling and toxin production can be investigated through:

  • Comparative metabolomic analysis: Profiling toxin production in wild-type versus sho1 mutant strains

  • Transcriptional regulation studies: Examining expression of toxin biosynthesis genes in response to Sho1 activation

  • Signal pathway inhibition: Using specific MAP kinase inhibitors to block Sho1-dependent signaling and measure effects on toxin production

Research has shown that isoamyl alcohol oxidase, which produces aspergilomarasmine derivatives responsible for chlorotic symptoms, is upregulated during P. teres infection . Establishing the regulatory connection between Sho1 signaling and the expression of such enzymes represents an important research direction.

How do barley resistance mechanisms interact with P. teres Sho1-mediated pathways?

The interaction between barley resistance mechanisms and P. teres Sho1-mediated pathways involves complex molecular dialogues:

Barley Defense ResponseP. teres Signaling ComponentInteraction Outcome
ROS production (oxidative burst)Sho1-MAPK pathwayActivation of fungal stress responses
Hypersensitive reaction (HR)Sho1-regulated virulence factorsContainment vs. spread of infection
Antioxidant enzyme upregulation (HvCSD1)Sho1-dependent redox signalingDetoxification of fungal ROS

During infection, barley upregulates genes like HvCSD1 (a cytosolic superoxide dismutase) that maintain cellular redox status . Sho1 signaling in P. teres may respond to this oxidative environment by activating appropriate stress adaptation mechanisms. Studying this molecular interplay requires dual-organism transcriptomics, targeted gene knockouts in both organisms, and protein-protein interaction studies at the host-pathogen interface.

How conserved is the Sho1 protein among different fungal plant pathogens?

Comparative genomic analysis reveals that Sho1 proteins are highly conserved among ascomycete fungi, with notable sequence and structural similarities across plant pathogenic species:

  • The membrane-spanning regions show high conservation (>70% similarity) across related species

  • The C-terminal signaling domains contain more variable regions that may confer species-specific functions

  • The SH3 domains involved in protein-protein interactions maintain structural conservation despite sequence divergence

Methodologically, researchers can investigate Sho1 conservation through phylogenetic analysis of sho1 genes across fungal genomes, structural modeling of protein domains, and functional complementation studies between heterologous systems. The amino acid sequence from P. teres f. teres Sho1 (UniProt: E3RIP0) serves as a reference for such comparative analyses .

What insights can be gained from studying genetic recombination involving the sho1 gene in P. teres populations?

Studying genetic recombination involving the sho1 gene can provide valuable insights into P. teres evolution and adaptation:

  • Population structure analysis reveals patterns of gene flow and selection

  • Identification of recombination hotspots near virulence-associated loci

  • Tracking the spread of advantageous alleles through fungal populations

  • Understanding the impact of sexual reproduction on genetic diversity

Recent research has demonstrated that sexual recombination occurs between P. teres isolates from cultivated barley and barley grass, potentially creating new virulence combinations . Methodologically, researchers can investigate recombination through genome sequencing of field isolates, analysis of linkage disequilibrium patterns around the sho1 locus, and experimental crosses between isolates with different sho1 alleles.

How has the sho1 gene evolved in the context of adaptation to different host species?

The evolution of the sho1 gene in P. teres has been shaped by adaptation to different host species, including cultivated barley and wild grass species like Agropyron, Bromus, Elymus, and other Hordeum species . Analysis of this evolutionary process requires:

  • Sequencing sho1 alleles from P. teres populations associated with different hosts

  • Identifying signatures of positive selection in coding regions

  • Functional testing of variant alleles through heterologous expression

  • Correlation of allelic variants with host-specific virulence profiles

Although wild grass species can be infected by P. teres, research suggests they do not contribute significant additional inoculum to barley crops . The evolutionary relationship between sho1 variants and host specificity represents an important area for further investigation, particularly in the context of disease management strategies.

How can Sho1 be targeted for the development of novel fungicides against P. teres?

Targeting Sho1 for antifungal development represents a promising strategy due to its essential role in fungal stress adaptation and potential virulence:

  • Structure-based drug design: Using the 3D structure of Sho1 to identify binding pockets for small-molecule inhibitors

  • Allosteric modulator screening: Identifying compounds that alter Sho1 conformation and disrupt signaling

  • Peptide-based inhibitors: Developing peptides that mimic interaction domains and block protein-protein interactions

  • Antisense technology: Testing RNA interference approaches to downregulate sho1 expression

Research methodologies would include in silico screening of chemical libraries, biochemical assays measuring Sho1 activation, and in vivo testing of promising compounds in infection models. Since P. teres has demonstrated capacity to develop fungicide resistance through sexual recombination , targeting conserved signaling nodes like Sho1 might offer more durable control strategies.

What techniques allow for real-time monitoring of Sho1 activity during infection processes?

Advanced imaging and biochemical techniques permit real-time monitoring of Sho1 activity:

  • FRET-based biosensors: Constructing Sho1 fusion proteins with fluorescent molecules that change emission properties upon activation

  • Phospho-specific antibodies: Developing antibodies that recognize activated forms of Sho1 for immunofluorescence imaging

  • Optogenetic tools: Engineering light-responsive Sho1 variants to probe signaling dynamics

  • Transcriptional reporters: Creating reporter constructs driven by Sho1-responsive promoters

Implementation requires genetic modification of P. teres to express these reporter constructs, followed by confocal microscopy during infection of transparent plant tissues. Time-lapse imaging with these tools can reveal the spatial and temporal dynamics of Sho1 signaling during key infection stages, from spore germination through host colonization .

How can systems biology approaches integrate Sho1 signaling with broader pathogenicity networks?

Systems biology offers powerful frameworks to integrate Sho1 signaling within the broader context of P. teres pathogenicity:

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data to build comprehensive network models

  • Network reconstruction: Mapping protein-protein interactions centered around Sho1 using high-throughput interaction studies

  • Computational modeling: Developing mathematical models that predict signaling outcomes under different environmental conditions

  • Comparative systems analysis: Examining how Sho1 networks differ between P. teres formae (teres and maculata)

During P. teres infection, multiple signaling pathways operate simultaneously, including those involved in ROS production, toxin biosynthesis, and stress adaptation . System-level analysis can reveal how Sho1 signaling intersects with these pathways and identify critical nodes for intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.