Recombinant Pyrenophora tritici-repentis Altered inheritance of mitochondria protein 31, mitochondrial (aim31)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pyrenophora tritici-repentis Altered Inheritance of Mitochondria Protein 31, Mitochondrial (Aim31)

The protein Aim31, originally identified through a screen for altered mitochondrial DNA inheritance, is now recognized as a key component in the assembly and function of the mitochondrial respiratory chain . In yeast, Aim31, also known as Rcf1 (respiratory supercomplex factor 1), is associated with the cytochrome $$bc_1$$-cytochrome $$c$$ oxidase (COX) supercomplex . This supercomplex is essential for electron transfer and energy production within the mitochondria .

Functional Role of Aim31/Rcf1

Aim31/Rcf1 plays a crucial role in the assembly and stability of the cytochrome $$bc_1$$-COX supercomplex . It interacts directly with the Cox3 subunit of the COX complex and facilitates the association of the COX complex with the cytochrome $$bc_1$$ complex . Additionally, Aim31/Rcf1 interacts with members of the ADP/ATP carrier (AAC) family, suggesting a role in coordinating OXPHOS activity with ATP/ADP levels in the mitochondria .

Key functions include:

  • Supercomplex Assembly: Acts as a bridge between the cytochrome $$bc_1$$ and COX complexes .

  • COX Enzyme Activity: Required for optimal COX enzyme activity .

  • Assembly of Peripheral COX Subunits: Facilitates the correct assembly of Cox12 and Cox13 subunits .

Relationship with Hig1 Protein Family

Aim31/Rcf1 is a member of the conserved hypoxia-induced gene 1 (Hig1) protein family . Hig1 family members are known to be involved in mitochondrial function and regulation . Aim31/Rcf1 shares functional overlap with another mitochondrial protein, Aim38/Rcf2, which also belongs to the Hig1-related protein family .

Aim31 and Aim38/Rcf1 and Rcf2 Functional Redundancy

Aim31/Rcf1 displays functional redundancy with Aim38/Rcf2 . The absence of either protein alone has a limited impact, but the combined loss of both Aim31/Rcf1 and Aim38/Rcf2 significantly impairs COX enzyme activity and the assembly of the cytochrome $$bc_1$$-COX supercomplex . Aim31/Rcf1 and Aim38/Rcf2 can independently associate with the cytochrome $$bc_1$$-COX supercomplex, suggesting the existence of multiple forms of this supercomplex within mitochondria .

RNA Editing and Mitochondrial Genomes

Research on plant mitochondrial genomes, such as in Rehmannia glutinosa and Photinia serratifolia, reveals the importance of RNA editing in mitochondrial gene expression . RNA editing involves the conversion of cytosine (C) to uracil (U), leading to changes in the amino acid sequence of the encoded proteins . These editing events can modify start and stop codons, influencing protein synthesis .

RNA Editing Sites in Plant Mitochondria

The number of RNA editing sites varies among different plant species . For instance, Photinia serratifolia exhibits 488 RNA editing sites within its protein-coding genes . The majority of these sites involve C-to-T conversions, with a high proportion occurring at the second codon position .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to meet specific requirements.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please specify this during ordering; we will prioritize fulfilling requests for specified tags whenever possible.
Synonyms
rcf1; aim31; PTRG_07056; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Pyrenophora tritici-repentis (strain Pt-1C-BFP) (Wheat tan spot fungus) (Drechslera tritici-repentis)
Target Names
rcf1
Target Protein Sequence
MSFGGPNSTPLPSSFDENADFYNENTIDKIWRRFREEPLVPLGCGLTVWAIVGATRSMRK GDHKMTNLYFRRRLYAQGFTIAVLVAGNMYWQKDRLKRKEYEKKVAEKDRMDKRDRWLRE LEMRDEEDKAWKERMAKKARGAADEAVGVTQMVKEKTKELKDQTVGK
Uniprot No.

Target Background

Function
A cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.
Database Links
Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Pyrenophora tritici-repentis and why is it significant in plant pathology?

Pyrenophora tritici-repentis (P. tritici-repentis) is the causal agent of tan spot disease of wheat, representing a significant plant pathogen with economic importance in agriculture. This fungal pathogen mediates disease primarily through the production of host-selective toxins (HSTs) that operate in an 'inverse' gene-for-gene manner, where toxin recognition by specific host receptors leads to disease susceptibility rather than resistance . P. tritici-repentis serves as a unique model for resolving mechanisms of pathogenicity and disease compatibility, which are currently not well understood in many plant-pathogen interactions .

The significance of this pathogen has prompted major genomic sequencing efforts, including the Pyrenophora genome project supported by the USDA, which aimed to produce a complete publicly available genome sequence to facilitate deeper understanding of disease mechanisms and potential control strategies . The genomic information generated from such projects provides researchers with essential tools to investigate virulence factors and pathogenicity determinants, including proteins like aim31.

How does aim31 relate to other proteins across fungal species?

The aim31 protein belongs to a conserved family of proteins found across various fungal species. Comparative analysis reveals homologous proteins in:

OrganismGene NameProtein NameFunction
Pyrenophora tritici-repentisPTRG_07056aim31Mitochondrial hypoxia responsive domain containing protein
Saccharomyces cerevisiaeAIM31/YML030wRcf1 (formerly Aim31)Component of cytochrome bc1-COX supercomplex
Magnaporthe oryzaeMGG_07223AIM31Altered inheritance of mitochondria protein 31
Pichia pastorisPAS_chr1-3_0297AIM31Altered inheritance of mitochondria protein 31

In S. cerevisiae, Aim31 (renamed Rcf1) displays high similarity to members of the Hypoxia-induced gene 1 (Hig1) protein family . Research has shown that in yeast, this protein associates with the cytochrome bc1-COX supercomplex and appears to bind to both the cytochrome bc1 and COX enzyme domains . Studies in yeast also indicate that Aim31/Rcf1 shares overlapping functions with another mitochondrial protein called Aim38/Rcf2 .

The conservation of this protein across diverse fungal species suggests it plays a fundamental role in mitochondrial function, particularly in respiration and possibly in adaptation to environmental stresses like hypoxia.

What experimental approaches are most effective for studying aim31 function in P. tritici-repentis?

Several experimental approaches can be employed to study aim31 function in P. tritici-repentis, with gene manipulation techniques being particularly informative:

  • Gene Replacement Methods: Based on approaches used for other genes in P. tritici-repentis, three primary methods have proven effective with varying efficiency:

    MethodDescriptionTransformation EfficiencyAdvantages/Disadvantages
    Linear Minimal Element (LME)Uses a small fragment fused to selection marker~4% homologous recombinationHigh number of transformants but low target specificity
    Large Linear FragmentUses extensive 5' and 3' flanking regions surrounding selection marker~40% homologous recombinationBetter specificity but potential for multiple insertions
    Split-marker ApproachUses two fragments overlapping in selection marker~60% homologous recombinationHighest specificity, recommended for P. tritici-repentis
  • Protein Localization Studies: Fluorescent protein tagging can determine subcellular localization within mitochondrial structures.

  • Protein-Protein Interaction Analysis: Co-immunoprecipitation and BN-PAGE (Blue Native Polyacrylamide Gel Electrophoresis) approaches similar to those used in yeast studies could identify interacting partners in respiratory complexes.

  • Functional Complementation: Heterologous expression in related species where the aim31 homolog has been deleted can test for functional conservation.

For effective gene replacement, the split-marker approach appears optimal for P. tritici-repentis based on studies with other genes, as it provides the highest percentage of gene-replacing recombinants with fewer incidents of multiple fragment insertions .

How might recombinant aim31 protein be used in functional studies?

Recombinant aim31 protein, which can be produced in expression systems such as E. coli, yeast, baculovirus, or mammalian cells with purities ≥85% as determined by SDS-PAGE , offers multiple applications for functional studies:

  • In vitro Binding Assays: Recombinant aim31 can be used to characterize binding affinities with potential interaction partners from mitochondrial respiratory complexes.

  • Structural Studies: Purified protein enables structural determination through X-ray crystallography or cryo-electron microscopy, providing insights into functional domains.

  • Antibody Production: Recombinant protein can generate specific antibodies for immunolocalization, co-immunoprecipitation, and Western blot analyses.

  • Enzymatic Activity Assays: If aim31 possesses enzymatic activity, recombinant protein allows for biochemical characterization of substrate specificity and kinetics.

  • Protein Reconstitution Experiments: Incorporation of purified aim31 into artificial membrane systems or isolated mitochondria lacking endogenous protein can test functional hypotheses.

When designing experiments with recombinant aim31, researchers should consider potential differences between the recombinant version and the native protein, particularly regarding post-translational modifications that may affect function but might be absent in bacterial expression systems.

What is the hypothesized relationship between aim31 and mitochondrial function in P. tritici-repentis?

Based on studies of homologous proteins in yeast, aim31 in P. tritici-repentis likely plays a significant role in mitochondrial respiratory function. In S. cerevisiae, the homologous protein Aim31/Rcf1 has been characterized as a component of the cytochrome bc1-COX supercomplex . This association suggests several hypothesized functions for aim31 in P. tritici-repentis:

  • Supercomplex Assembly/Stability: Aim31 may function as a bridge between respiratory complex components, supporting the assembly of supercomplex structures that optimize electron transfer efficiency.

  • Hypoxia Response Mediator: The presence of hypoxia-responsive domains suggests aim31 could help regulate mitochondrial function under oxygen-limited conditions, potentially important during certain stages of plant infection.

  • Mitochondrial DNA Inheritance: The name "Altered inheritance of mitochondria" suggests a potential role in maintaining or segregating mitochondrial DNA during cell division, which could impact fungal fitness and stress adaptation.

  • Respiratory Efficiency Modulator: By interacting with respiratory complexes, aim31 may fine-tune electron transport and oxidative phosphorylation efficiency under varying environmental conditions.

Studies in yeast have shown that loss of Aim31/Rcf1 along with the related protein Aim38/Rcf2 significantly impacts cytochrome oxidase (COX) enzyme activity and assembly of peripheral COX subunits . This suggests aim31 in P. tritici-repentis may similarly impact respiratory complex assembly and function, potentially affecting energy production during critical stages of fungal development or pathogenesis.

How might aim31 contribute to pathogenicity mechanisms in P. tritici-repentis?

The potential contributions of aim31 to P. tritici-repentis pathogenicity can be hypothesized based on our understanding of mitochondrial function in fungal pathogens:

  • Energy Production for Virulence: Efficient mitochondrial function is critical for producing the energy required for host colonization, toxin production, and other pathogenicity mechanisms. If aim31 enhances respiratory efficiency under infection conditions, it could indirectly support virulence.

  • Stress Adaptation During Infection: Plant infection environments often include oxidative stress and fluctuating oxygen levels. As a hypoxia-responsive protein, aim31 might help the fungus adapt to these changing conditions within host tissues.

  • Cellular Redox Balance: Mitochondrial respiratory complexes influence cellular redox status, which can affect the production or activity of certain virulence factors, including host-selective toxins.

  • Toxin Production Support: The production of host-selective toxins like ToxA requires substantial cellular resources. Optimized mitochondrial function via aim31 could support the metabolic demands of toxin biosynthesis and secretion.

  • Growth in planta: Studies of ToxA have provided preliminary evidence that certain virulence factors may provide additional benefits to fungal growth in planta even in the absence of their cognate recognition partners in the host . Similarly, aim31 might confer growth advantages within the plant environment independent of direct pathogenicity functions.

Future research using aim31 knockout strains in pathogenicity assays would help determine whether this protein directly or indirectly contributes to the infection process and disease development in wheat.

What comparative genomic approaches are valuable for studying aim31 across fungal species?

Comparative genomic approaches provide powerful tools for understanding aim31 evolution and function across fungal species. Several strategic approaches include:

  • Phylogenetic Analysis of aim31 Homologs:

    • Constructing phylogenetic trees to track evolutionary relationships of aim31 proteins across fungal lineages

    • Identifying conserved domains that may be critical for function

    • Detecting lineage-specific adaptations that might relate to specialized ecological niches

  • Synteny Analysis:

    • Examining conservation of gene order surrounding aim31 across species

    • Identifying potential co-regulated genes through proximity analysis

    • Detecting genomic rearrangements that might affect aim31 regulation

  • Transcriptional Regulatory Element Comparison:

    • Analyzing promoter regions of aim31 homologs to identify conserved transcription factor binding sites

    • Predicting condition-specific regulation based on regulatory element conservation

    • Correlating regulatory elements with known environmental response pathways

  • Correlation with Pathogenicity Traits:

    • Comparing aim31 sequence and domain organization between pathogenic and non-pathogenic fungi

    • Identifying potential pathogenicity-associated modifications or adaptations

    • Correlating aim31 variants with host range or virulence levels

The Pyrenophora genome project at the Broad Institute has explicitly stated that the P. tritici-repentis genome sequence provides "robust sampling of the Pleosporales for comparative genomic studies by the fungal community" . This resource, combined with EST data and functional genomics approaches, enables researchers to place aim31 in an evolutionary context and generate hypotheses about its specialized functions in different fungal lineages.

What quality control measures should be implemented when working with recombinant aim31?

When working with recombinant Pyrenophora tritici-repentis aim31 protein, several quality control measures are essential:

  • Purity Assessment:

    • SDS-PAGE analysis to confirm ≥85% purity as standard for commercial preparations

    • Western blotting with specific antibodies to verify protein identity

    • Mass spectrometry to confirm correct amino acid sequence and identify any post-translational modifications

  • Functional Validation:

    • Binding assays with known interaction partners (based on homolog studies)

    • Circular dichroism spectroscopy to assess proper protein folding

    • Activity assays appropriate to predicted function

  • Stability Monitoring:

    • Thermal shift assays to determine stability under various buffer conditions

    • Time-course experiments to track degradation at different storage temperatures

    • Oligomerization state analysis through size exclusion chromatography

  • Expression System Considerations:

    • Different expression systems (E. coli, yeast, baculovirus, mammalian cells) may produce proteins with varying properties

    • Verification that the recombinant protein includes all functional domains

    • Assessment of any expression system-specific modifications or tags that might affect function

Implementing these quality control measures ensures that experimental results with recombinant aim31 are reliable and reproducible, particularly for sensitive functional studies or structural analyses.

How can gene replacement techniques be optimized for studying aim31 in P. tritici-repentis?

Based on the gene replacement studies conducted for other genes in P. tritici-repentis, several optimization strategies can be applied specifically to aim31 research:

  • Selection of Optimal Replacement Method:

    • The split-marker approach has demonstrated superior efficiency (~60% homologous recombination) compared to large linear fragments (~40%) or Linear Minimal Element approaches (~4%) in P. tritici-repentis

    • This approach involves using two fragments that overlap in the selection marker gene, reducing non-homologous integration

  • Flanking Region Design:

    • Using extensive 5' and 3' flanking regions (>1 kb) surrounding the aim31 gene

    • Avoiding repetitive sequences in flanking regions that might lead to non-specific recombination

    • Ensuring unique primer binding sites for efficient screening

  • Transformation Protocol Optimization:

    • Protoplast quality significantly impacts transformation efficiency

    • Optimal osmotic stabilizers and regeneration media should be empirically determined

    • Fresh mycelial tissue typically yields better protoplasts than aged cultures

  • Rigorous Screening Process:

    • PCR verification of both aim31 gene deletion and correct integration of the replacement construct

    • Quantitative PCR to determine copy number of the replacement construct, ensuring single integration events

    • Southern blot analysis as a secondary confirmation method

  • Phenotypic Validation:

    • Complementation studies to confirm phenotypes are specifically due to aim31 disruption

    • Comparison with known phenotypes of homologous gene deletions in model organisms

By implementing these optimized approaches, researchers can efficiently generate aim31 deletion or replacement mutants in P. tritici-repentis to investigate the protein's role in mitochondrial function and potential contributions to fungal pathogenicity.

What emerging technologies might advance understanding of aim31 function?

Several cutting-edge technologies show promise for elucidating aim31 function in P. tritici-repentis:

  • CRISPR-Cas9 Gene Editing:

    • More precise aim31 modifications beyond traditional gene deletion

    • Introduction of point mutations to study specific domain functions

    • Creation of tagged versions at endogenous loci for localization studies

  • Single-Cell Transcriptomics:

    • Analysis of aim31 expression heterogeneity within fungal populations

    • Correlation with mitochondrial gene expression patterns

    • Identification of condition-specific regulation during infection

  • Advanced Proteomics:

    • Proximity labeling techniques (BioID, APEX) to identify aim31 interaction networks

    • Quantitative proteomics to measure changes in mitochondrial protein composition in aim31 mutants

    • Analysis of post-translational modifications that might regulate aim31 function

  • Cryo-Electron Tomography:

    • Visualization of aim31's position within native mitochondrial membrane complexes

    • Structural analysis of how aim31 influences supercomplex assembly

    • Detection of conformational changes under different physiological conditions

  • Metabolic Flux Analysis:

    • Measuring how aim31 deletion affects carbon metabolism and energy production

    • Identifying metabolic bottlenecks in mutants that might explain phenotypes

    • Correlating metabolic changes with pathogenicity determinants

These technologies, combined with the genomic resources available through the Pyrenophora genome project , will provide unprecedented insights into aim31 function and its role in fungal physiology and pathogenicity.

How might aim31 research contribute to broader understanding of fungal mitochondrial biology?

Research on the P. tritici-repentis aim31 protein has significant potential to contribute to our broader understanding of fungal mitochondrial biology in several important ways:

  • Evolutionary Conservation of Respiratory Complexes:

    • Comparison with the well-studied yeast homolog Aim31/Rcf1 can reveal conserved and divergent features of mitochondrial respiratory complex assembly

    • Understanding how these complexes evolved in filamentous plant pathogenic fungi versus unicellular yeasts

  • Mitochondrial Adaptation to Plant Environments:

    • Insights into how fungal mitochondria adapt to the unique challenges of plant colonization

    • Understanding mitochondrial responses to plant defense compounds and oxidative bursts

  • Specialized Metabolism Support:

    • Connections between mitochondrial function and the production of specialized metabolites involved in plant-pathogen interactions

    • How mitochondrial proteins like aim31 might support the high energy demands of virulence factor production

  • Stress Response Integration:

    • Understanding how hypoxia-responsive mitochondrial proteins coordinate with other cellular stress responses

    • Potential roles in fungal stress adaptation and survival in changing environments

  • Novel Antifungal Targets:

    • Identification of mitochondrial vulnerabilities that might be exploited for disease control

    • Comparative analysis with human mitochondrial proteins to identify fungal-specific targets

By placing aim31 research in this broader context, findings from P. tritici-repentis studies can contribute to fundamental knowledge of mitochondrial biology while simultaneously advancing applied research on controlling economically important plant diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.