Recombinant Pyrenophora tritici-repentis Bifunctional lycopene cyclase/phytoene synthase (PTRG_07366)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

Recombinant PTRG_07366 is commercially available as a lyophilized protein (e.g., Creative BioMart Cat. No. RFL34273PF). Key specifications include:

ParameterDescription
Expression SystemE. coli
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with optional 50% glycerol
Sequence VerificationFull-length (1–583 aa): MGFDYALVHLKYTIPPAVLLTWLYRPFFTKLDVYKVGYLVSIAVASTIPW...

Stability tests recommend avoiding repeated freeze-thaw cycles and storing aliquots at -80°C .

Enzymatic Activities and Pathway Role

PTRG_07366 operates in the carotenoid biosynthesis pathway:

  1. Phytoene synthase activity:

    2 GGPPPhytoene+2 Diphosphate[1][6]2 \text{ GGPP} \rightarrow \text{Phytoene} + 2 \text{ Diphosphate} \quad[1][6]
  2. Lycopene cyclase activity:

    Lycopeneγ-Caroteneβ-Carotene[1][8]\text{Lycopene} \rightarrow \gamma\text{-Carotene} \rightarrow \beta\text{-Carotene} \quad[1][8]

Functional studies in homologous fungi (e.g., Phycomyces blakesleeanus) confirm that bifunctional enzymes like PTRG_07366 regulate pathway flux and respond to environmental stimuli . Mutations in analogous genes (e.g., carRA in Phycomyces) lead to albino or hyperpigmented phenotypes, underscoring their critical role .

Research Applications

  • Carotenoid Engineering: Used to study metabolic bottlenecks in microbial β-carotene production .

  • Fungal Pathogenesis: While not directly linked to Pyrenophora virulence , carotenoids may protect the fungus from host oxidative stress .

  • Comparative Genomics: Serves as a model for studying gene fusion events in fungal secondary metabolism .

Limitations and Future Directions

  • Structural Data: No crystal structure is available, hindering mechanistic studies.

  • In Planta Expression: RNA-seq data from Pyrenophora-wheat interactions do not highlight PTRG_07366 upregulation during infection , suggesting its role is constitutive rather than virulence-associated.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C is recommended. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
PTRG_07366; Bifunctional lycopene cyclase/phytoene synthase [Includes: Lycopene beta-cyclase; Lycopene cyclase; Phytoene synthase; ]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-583
Protein Length
full length protein
Species
Pyrenophora tritici-repentis (strain Pt-1C-BFP) (Wheat tan spot fungus) (Drechslera tritici-repentis)
Target Names
PTRG_07366
Target Protein Sequence
MGFDYALVHLKYTIPPAVLLTWLYRPFFTKLDVYKVGYLVSIAVASTIPWDSYLIRTGIW SYPTHVIIGPKLCDIPLEEVFFFIIQTYNTSLLYLLLSRPTFQPVYLNTERGAARRQWRY MRLAGQVFFLALIAWGWRCIRHGGLGTYTGLILVWAGPFLLMLWSLAYQFILALPVTNTA LPIFLPTLYLWVVDTLALRRGTWVISTGTKYGLHLWDGLEIEEALFFLATNALIVFGQLA FDNALAVLYTFPHLFTGPSLLPSPVLLMRALLTPCSKYHDARIKGLDEAVNRLKRKSRSF YLASATFPGPLRADLLLLYSFCRVADDLVDNASDADEARAWIAKMRKFLNNVYSDKLPQS VVHSQICDDFPPSTQSALLQLPATKLSPQPLEDLLHGFEMDLAFQQGPIIRTMEDLRVYS ERVAGTVAQMCIQLIFYWYPSTLDTEEKNVIVAAGNSMGVALQYVNIARDIEVDAQIGRV YLPLNWLSEAGLSYDDVLKKPNQAQIQTLRKHLLNHAFSVYEKAKDSIERLPIEARGPIR VAVESYMEIGRILRSEQYQVKAGRATVPKSRRIMVAWRTLNSK
Uniprot No.

Target Background

Function
This bifunctional enzyme catalyzes the reactions from geranylgeranyl diphosphate to phytoene (phytoene synthase) and lycopene to beta-carotene via the intermediate gamma-carotene (lycopene cyclase).
Database Links
Protein Families
Lycopene beta-cyclase family; Phytoene/squalene synthase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Pyrenophora tritici-repentis Bifunctional lycopene cyclase/phytoene synthase?

This recombinant protein is derived from the wheat tan spot fungus Pyrenophora tritici-repentis (strain Pt-1C-BFP). It contains two distinct enzymatic domains: lycopene beta-cyclase (EC 5.5.1.19) and phytoene synthase (EC 2.5.1.32). The protein is identified by UniProt accession number B2WAQ3 and is typically available as a partial recombinant protein produced in E. coli expression systems. The gene encoding this protein is designated as PTRG_07366 .

What are the key specifications of the commercially available recombinant protein?

The following table summarizes the key specifications of the commercially available recombinant protein:

PropertyValue
Product CodeCSB-EP453152FHT1-B
UniProt AccessionB2WAQ3
Source OrganismPyrenophora tritici-repentis (strain Pt-1C-BFP)
Production SystemE. coli
Purity>85% (SDS-PAGE)
Protein LengthPartial
Storage (Liquid Form)6 months at -20°C/-80°C
Storage (Lyophilized Form)12 months at -20°C/-80°C
Short-term StorageUp to one week at 4°C

Source: Product specifications

What enzymatic functions does this bifunctional protein perform?

This protein integrates two critical enzymatic functions in carotenoid biosynthesis:

  • Lycopene beta-cyclase (EC 5.5.1.19): Catalyzes the cyclization of linear lycopene molecules to form beta-carotene by introducing beta-ionone rings at both ends of the molecule

  • Phytoene synthase (EC 2.5.1.32): Catalyzes the first committed step in carotenoid biosynthesis, converting two molecules of geranylgeranyl pyrophosphate (GGPP) to phytoene through condensation

This bifunctional nature suggests a metabolic channeling mechanism where the product of one enzymatic domain may serve as the substrate for the other domain .

What are the optimal storage conditions for maintaining enzymatic activity?

The shelf life of this protein depends on several factors including storage state, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself. According to product specifications:

  • Liquid form can be stored for approximately 6 months at -20°C/-80°C

  • Lyophilized form maintains stability for approximately 12 months at -20°C/-80°C

  • For short-term usage, working aliquots can be stored at 4°C for up to one week

Importantly, repeated freezing and thawing cycles should be avoided as they significantly reduce enzymatic activity .

What is the recommended reconstitution protocol?

For optimal reconstitution results, follow this methodological approach:

  • Briefly centrifuge the vial prior to opening to bring the contents to the bottom

  • Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration between 5-50% (with 50% being the default recommendation)

  • Prepare small aliquots for long-term storage at -20°C/-80°C to minimize freeze-thaw cycles

This procedure helps maintain protein stability and enzymatic activity for experimental applications .

How can researchers assay the enzymatic activities of this bifunctional protein?

Although not directly addressed in the search results, standard methodological approaches for these enzymatic activities include:

For Phytoene Synthase activity:

  • Substrate: Geranylgeranyl pyrophosphate (GGPP)

  • Product detection: HPLC analysis with UV detection at 286 nm

  • Alternative: Coupled spectrophotometric assays monitoring GGPP consumption

For Lycopene Cyclase activity:

  • Substrate: Lycopene

  • Product detection: HPLC analysis with visible detection at 450-470 nm

  • Confirmation: Spectrophotometric shifts in absorption spectra as cyclic products form

For differential analysis, specific inhibitors can be employed to selectively block one activity while measuring the other.

What challenges might researchers encounter when expressing this recombinant protein?

Based on general principles for recombinant protein expression, researchers should anticipate several challenges:

  • Protein folding complexity: Bifunctional enzymes often contain complex tertiary structures that may not fold properly in heterologous expression systems

  • Expression efficiency issues: As with many full-length proteins, expression can be affected by factors including hydrophobicity, codon usage bias, and potential toxicity to the host organism

  • Solubility concerns: The protein may form inclusion bodies in bacterial expression systems, particularly if it contains membrane-associated domains

  • Post-translational modifications: The native fungal protein may require specific modifications that bacterial systems cannot provide

  • Translation initiation problems: Issues with truncated products may occur due to proteolysis or improper translation initiation

What approaches can optimize expression of this recombinant protein?

Several methodological strategies can improve expression outcomes:

  • Codon optimization: Adapting the coding sequence to match E. coli codon usage preferences can significantly enhance translation efficiency

  • Expression vector selection: Utilizing vectors with appropriate promoters (T7, tac) and fusion tags (His-tag, GST, MBP) can improve expression and solubility

  • Host strain selection: Specialized E. coli strains designed for proteins with rare codons or disulfide bonds may yield better results

  • Culture condition optimization: Adjusting parameters such as:

    • Induction temperature (often lowered to 16-25°C to slow expression and improve folding)

    • IPTG concentration (typically 0.1-1.0 mM)

    • Media composition (enriched media for higher biomass)

    • Induction timing (typically mid-log phase)

  • Solubility enhancement: For problematic expressions, fusion partners like thioredoxin or NusA can significantly improve protein solubility

What is the biological significance of this bifunctional enzyme in Pyrenophora tritici-repentis?

Pyrenophora tritici-repentis is the causal agent of tan spot disease in wheat, which has become increasingly prevalent in regions like Tunisia over the past decade . While the search results don't directly address the role of this specific enzyme in pathogenicity, several hypotheses can be proposed:

  • The bifunctional enzyme likely plays a key role in carotenoid biosynthesis, which may protect the fungus from oxidative stress during plant infection

  • Carotenoids or their derivatives might modulate the expression or activity of known virulence factors such as ToxA and ToxB

  • The bifunctional enzyme architecture might provide metabolic advantages through substrate channeling, potentially enhancing fitness during host colonization

Future research could explore correlations between enzyme activity, carotenoid production, and virulence across different fungal races .

How does this bifunctional enzyme relate to the known effector proteins in Pyrenophora tritici-repentis?

Pyrenophora tritici-repentis produces several effector proteins, including ToxA, ToxB, and toxb (a ToxB homolog), which contribute to its virulence by inducing necrosis and chlorosis in susceptible wheat genotypes . The search results indicate that:

  • ToxA was present in 51% of studied isolates and is associated with necrosis development in susceptible wheat

  • ToxB and its homolog toxb were highly prevalent (97% and 93% respectively) in tested isolates

  • Different races of the fungus show distinct patterns of these effector genes

Interestingly, 44% of isolates that caused typical necrotic symptoms lacked the ToxA gene, suggesting the existence of additional necrosis-inducing factors . The relationship between this bifunctional enzyme and these effector proteins requires further investigation.

How does the fungal bifunctional enzyme compare to similar enzymes in other organisms?

While the search results don't provide direct comparative information, several important distinctions can be inferred:

  • Architectural differences: In most plants and other organisms, lycopene cyclase and phytoene synthase exist as separate enzymes, whereas this fungal protein combines both functions in a single polypeptide

  • Evolutionary implications: The bifunctional architecture in fungi may represent an evolutionary adaptation providing metabolic advantages through:

    • Substrate channeling (direct transfer of intermediates between active sites)

    • Coordinated regulation of both enzymatic activities

    • Potential enhancement of catalytic efficiency

  • Functional conservation: Despite architectural differences, the catalytic mechanisms likely remain conserved across different taxonomic groups

Understanding these differences could provide insights into the evolution of carotenoid biosynthesis pathways across different kingdoms.

What techniques can researchers use to study the structure-function relationship of this bifunctional enzyme?

Several advanced methodological approaches would be appropriate:

  • X-ray crystallography or cryo-EM: To determine the three-dimensional structure and understand how the two catalytic domains are spatially arranged

  • Site-directed mutagenesis: Targeting conserved residues in each domain to identify catalytically essential amino acids

  • Domain truncation/swapping experiments: Creating constructs with single domains or chimeric proteins to understand domain interactions

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To identify flexible regions and potential conformational changes during catalysis

  • Molecular dynamics simulations: To model substrate binding and potential conformational changes during the catalytic cycle

These approaches could reveal how the structural organization enables the dual enzymatic functions and potential substrate channeling between domains.

How can researchers investigate protein-protein interactions involving this enzyme?

Several complementary techniques could be employed:

  • Co-immunoprecipitation (Co-IP): Using antibodies against the recombinant protein to pull down interacting partners from fungal extracts

  • Yeast two-hybrid (Y2H) screening: Using the enzyme or its individual domains as bait to identify potential interacting proteins

  • Proximity-dependent biotin identification (BioID): Fusing the enzyme to a biotin ligase to identify proximal proteins in vivo

  • Crosslinking coupled with mass spectrometry: To identify interaction sites and capture transient interactions

  • Surface plasmon resonance (SPR): To measure binding kinetics and affinities between the enzyme and potential interacting proteins

These approaches would help elucidate the protein interaction network and potentially reveal roles in metabolic complexes or signaling pathways.

What are the challenges in purifying active recombinant enzyme for structural studies?

Researchers pursuing structural studies face several methodological challenges:

  • Protein stability: Maintaining the native conformation and activity during purification requires careful buffer optimization

  • Protein homogeneity: Achieving the monodispersity required for crystallization or cryo-EM analysis can be challenging for multi-domain proteins

  • Protein yield: Obtaining sufficient quantities of properly folded protein for structural studies often requires extensive optimization

  • Post-translational modifications: The bacterial expression system may not reproduce important modifications present in the native fungal protein

  • Protein tagging strategy: The position and nature of affinity tags can impact both activity and crystallization properties

Using techniques like thermal shift assays to identify stabilizing buffer conditions and limited proteolysis to identify stable domains can significantly improve purification outcomes.

How might this bifunctional enzyme be utilized for optimized lycopene production?

Research on lycopene production in yeast systems has identified several challenges, including lycopene toxicity as a limiting factor for high-level production . The bifunctional nature of this enzyme presents interesting possibilities:

  • Pathway engineering: The dual functionality could potentially be exploited to balance the flux between phytoene synthesis and lycopene cyclization

  • Enzyme engineering opportunities: Directed evolution approaches similar to those used for CrtE and CrtB could be applied to enhance the activity of specific domains or alter product specificity

  • Reduction of lycopene toxicity: Understanding how the enzyme participates in the natural carotenoid pathway could inform strategies to mitigate lycopene toxicity, potentially through coordinated expression with other pathway components

  • Membrane integration: The observation that increasing unsaturated fatty acid content in cell membranes relieves lycopene toxicity suggests potential synergies between membrane engineering and optimal expression of this bifunctional enzyme

The ability to either enhance or attenuate specific domains of this bifunctional enzyme could provide unique advantages for metabolic engineering applications.

What directed evolution strategies might be applied to this bifunctional enzyme?

Building on strategies used for other carotenoid pathway enzymes , researchers could consider:

  • Domain-specific random mutagenesis: Targeting each catalytic domain separately to enhance specific activities

  • Active site saturation mutagenesis: Focusing on residues lining the substrate binding pockets to alter substrate specificity or improve catalytic efficiency

  • DNA shuffling approaches: Creating chimeric enzymes by recombining this bifunctional enzyme with homologs from other organisms

  • High-throughput screening methods: Developing colorimetric or fluorescence-based assays to rapidly identify improved variants based on carotenoid production

Such approaches could yield enzyme variants with enhanced stability, altered product profiles, or improved catalytic efficiency for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.