Recombinant Pyrenophora tritici-repentis Formation of crista junctions protein 1 (FCJ1)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview

FCJ1 belongs to the mitofilin protein family and functions as a critical architectural element in mitochondria. Originally characterized in yeast (Saccharomyces cerevisiae), FCJ1 homologs have been identified across various species, including the plant pathogenic fungus Pyrenophora tritici-repentis, which causes tan spot disease in wheat . The protein localizes specifically to crista junctions (CJs), which are tubular invaginations of the inner mitochondrial membrane that connect the inner boundary membrane with the cristae membrane .

These junction points are crucial for maintaining proper mitochondrial function, including respiratory chain activity, protein import, and lipid transfer. Research has demonstrated that FCJ1 interacts antagonistically with F1F0-ATP synthase subunits to control membrane curvature, thereby regulating the formation of these critical ultrastructural features . The recombinant form of FCJ1 from Pyrenophora tritici-repentis provides researchers with a valuable tool for investigating the molecular mechanisms underlying mitochondrial architecture and its relationship to organelle function.

Protein Structure and Domains

The FCJ1 protein exhibits several conserved structural features that are essential for its function in mitochondrial architecture. These include:

  1. An N-terminal mitochondrial targeting sequence that directs the protein to mitochondria

  2. A single transmembrane segment located near the N-terminus that anchors the protein in the inner mitochondrial membrane

  3. A coiled-coil domain that facilitates protein-protein interactions

  4. A highly conserved C-terminal domain that is essential for FCJ1 function

The C-terminal domain represents the most evolutionarily conserved region of the protein and plays a critical role in mediating interactions with other proteins, including self-association for oligomer formation and binding to the TOB/SAM complex (Translocase of Outer membrane β-barrel proteins/Sorting and Assembly Machinery) . This domain is therefore indispensable for the formation and stabilization of crista junctions.

Gene and Nomenclature Information

The FCJ1 gene in Pyrenophora tritici-repentis is identified by the ORF name PTRG_07069 . In yeast, the homologous gene is known as AIM28/FMP13/YKR016w . The protein shares approximately 13% sequence identity with human mitofilin and 12% with mouse mitofilin, with higher conservation in the C-terminal domain . The gene name FCJ1 specifically refers to its function: Formation of Crista Junctions protein 1. Alternative names include MIC60 and mitofilin, the latter being more commonly used for mammalian homologs .

Role in Crista Junction Formation

FCJ1 plays a fundamental role in establishing and maintaining crista junctions in mitochondria. Experimental evidence from yeast models has demonstrated that:

  1. FCJ1 is specifically enriched at crista junctions, making it a unique marker protein for these structures

  2. Cells lacking FCJ1 completely lose crista junctions and develop abnormal inner membrane structures, including concentric stacks of inner membrane within the mitochondrial matrix

  3. Overexpression of FCJ1 increases crista junction formation, promotes branching of cristae, and enlarges crista junction diameter

  4. FCJ1 is the only protein identified so far that specifically localizes to and is enriched at crista junctions

These findings establish FCJ1 as a primary determinant of mitochondrial inner membrane architecture and essential for the formation of crista junctions.

Antagonistic Relationship with F1F0-ATP Synthase

FCJ1 functions in a dynamic, antagonistic relationship with the F1F0-ATP synthase, particularly its subunits e and g (Su e/g). This relationship is key to controlling membrane curvature in mitochondria:

  1. Deletion of FCJ1 results in increased levels of F1F0-ATP synthase supercomplexes

  2. Conversely, overexpression of FCJ1 reduces the levels of these supercomplexes

  3. When F1F0-ATP synthase subunits e/g are deleted, cristae structure is altered, with enlarged crista junction diameters, reduced cristae tip numbers, and increased cristae branching

  4. Genetic interaction studies confirm a functional relationship between FCJ1 and subunits e/g

  5. Deleting F1F0-ATP synthase dimerization factors can restore tubular mitochondrial morphology in cells lacking FCJ1

These observations support a model in which the opposition between FCJ1 and F1F0-ATP synthase locally modulates membrane curvature, generating both crista junctions and cristae tips through differential distribution of these proteins along the inner membrane .

Interaction with the TOB/SAM Complex

A significant finding is that FCJ1, particularly its C-terminal domain, interacts with the TOB/SAM complex, which is responsible for inserting β-barrel proteins into the outer mitochondrial membrane:

  1. The C-terminal domain of FCJ1 interacts with Tob55, a component of the TOB/SAM complex

  2. This interaction is essential for stabilizing crista junctions in close proximity to the outer membrane

  3. The association of the TOB/SAM complex with contact sites depends on the presence of FCJ1

  4. Down-regulation of the TOB/SAM complex leads to altered cristae morphology and a moderate reduction in crista junction numbers

This interaction suggests that FCJ1 helps position crista junctions close to the outer membrane, providing a physical link between inner membrane structures and the protein insertion machinery in the outer membrane .

Impact on Mitochondrial DNA Organization

FCJ1 also influences the organization and distribution of mitochondrial DNA (mtDNA) nucleoids:

  1. Deletion of FCJ1 and Mos1 (another protein involved in mitochondrial morphology) causes aggregation of mtDNA nucleoids

  2. FCJ1 forms punctate structures and localizes adjacent to nucleoids

  3. The disruption of mtDNA organization is enhanced when mitochondrial division is impaired by deletion of DNM1

  4. FCJ1 and Mos1 are critical for establishing tubular morphology of mitochondria, as mitochondria lacking these proteins form abnormal lamellar sheets

These findings reveal an unexpected role for FCJ1 in maintaining the proper distribution and size of mtDNA nucleoids, linking mitochondrial membrane architecture to nucleoid organization .

Expression and Purification Methods

Recombinant Pyrenophora tritici-repentis FCJ1 protein is produced using bacterial expression systems for research and commercial applications:

  1. The protein is expressed in Escherichia coli as a recombinant construct typically spanning amino acids 17-641 of the mature protein

  2. For purification and detection purposes, the recombinant protein is commonly fused to an N-terminal His tag

  3. The expressed protein undergoes purification to achieve greater than 90% purity as determined by SDS-PAGE analysis

The use of E. coli as an expression host allows for high-yield production of the protein while maintaining its structural integrity for research applications.

Physical and Biochemical Properties

Table 1: Physical and Biochemical Properties of Recombinant FCJ1

PropertyCharacteristic
FormLyophilized powder
SourceE. coli expression system
TagHis tag (N-terminal)
Protein LengthFull Length of Mature Protein (17-641)
Purity>90% by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)

The recombinant protein is typically supplied as a lyophilized powder to ensure stability during shipping and long-term storage . Upon reconstitution, the protein maintains its structural and functional properties, making it suitable for various experimental applications.

Immunological Applications

The recombinant protein is valuable for generating specific antibodies and developing immunological tools:

  1. Production of polyclonal or monoclonal antibodies for immunodetection methods such as Western blotting, immunofluorescence, and immunogold electron microscopy

  2. Development of immunoassays for detecting and quantifying FCJ1 in various experimental systems

  3. Immunoprecipitation studies to identify and characterize FCJ1 interaction partners in different cellular contexts

These tools facilitate the investigation of FCJ1 expression, localization, and interactions in diverse experimental settings.

Biotechnological and Medical Relevance

Understanding FCJ1 function has potential implications for biotechnology and medicine:

  1. As Pyrenophora tritici-repentis is a plant pathogen causing tan spot disease in wheat, insights into its proteins may contribute to developing strategies for crop protection

  2. Given FCJ1's crucial role in mitochondrial structure, it represents a potential target for studies related to mitochondrial diseases and disorders in humans

  3. The protein's role in organizing mtDNA nucleoids suggests potential applications in understanding and addressing mitochondrial DNA-related pathologies

  4. Knowledge of the mechanisms controlling mitochondrial architecture may inform therapeutic strategies targeting mitochondrial dysfunction in various diseases

These applications highlight the broader significance of FCJ1 research beyond fundamental cell biology.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
MIC60; PTRG_07069; MICOS complex subunit MIC60; Mitofilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
17-641
Protein Length
Full Length of Mature Protein
Species
Pyrenophora tritici-repentis (strain Pt-1C-BFP) (Wheat tan spot fungus) (Drechslera tritici-repentis)
Target Names
MIC60
Target Protein Sequence
ARAARPQWHVAQRFYVDDKKNLGETAVPNPAPTTQPSSSPSNPTPVQENTIPASEVPKGP PAPDSTIGASRDAPTTQPSTTPPTGTGTASVAPDPIKPLPKKKRRRFRRFLLWLTILSGL GYAGGVWYSLVSDNFHDFFTEYIPYGEDAVAYFEEREFRRRFPGRAGEPRLHPQISGENK VTIPGRSGLTARPAKENSSDLASRGPHVSAVDDNKKQDKTESGGQQPKVSSQTPVAKEQP VQATETASSKAITPLDHLNVPSATEPVVQDVVKIVNDIITVVNADNAHDGKYNSALDKAK SELTKVVSDINAMKETLEQQAEAKVKAAHAEFDQAAKELIQRLDHQMQAQETQFKEEFEN ERERLSQSYKERLQSELQAAQKVYEQSLKNRLLEQSIKMQKSFTATVRERVEAEREGRLG KLNELSSSVHELEKLTAEWNSVVDANLKTQHLVVAVEAVKSALETQVVPKPFVTELAALK EIAADDPVVSAAIASINPAAYQRGIPSSALLIDRFRRVAGEVRKAALLPEDAGMASHLAS LAMSKVLFKKSGLAVGADVEAVLARTEVLLEEGDLDAAAREMNGLQGWAKVLSKDWLSEC RRVLEVKQALDVIATEARLNSLLID
Uniprot No.

Target Background

Function
FCJ1 is a component of the MICOS complex, a large protein assembly located within the mitochondrial inner membrane. This complex plays crucial roles in maintaining crista junctions, the architecture of the inner membrane, and the formation of contact sites with the outer membrane. FCJ1 contributes to the connectivity between cristae membranes and the inner boundary membrane. It also promotes protein import through the mitochondrial intermembrane space assembly (MIA) pathway.
Database Links
Protein Families
MICOS complex subunit Mic60 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the basic structure of Pyrenophora tritici-repentis FCJ1 protein?

Pyrenophora tritici-repentis FCJ1 is a full-length protein consisting of 625 amino acids (positions 17-641). The mature protein contains several functional domains, including a transmembrane domain and a C-terminal domain that is crucial for its function. When expressed recombinantly, it can be fused to an N-terminal His tag to facilitate purification and detection. The complete amino acid sequence is available and includes regions responsible for membrane anchoring and interaction with other mitochondrial proteins .

How is recombinant FCJ1 typically produced and purified for research applications?

Recombinant FCJ1 protein is typically expressed in E. coli expression systems. The full-length mature protein (amino acids 17-641) from Pyrenophora tritici-repentis is commonly fused to an N-terminal His tag to facilitate purification . After expression, the protein is purified to greater than 90% purity as determined by SDS-PAGE. The purified protein is often provided as a lyophilized powder and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, it is recommended to add 5-50% glycerol (with 50% being the default concentration) and store as aliquots at -20°C/-80°C to avoid repeated freeze-thaw cycles .

How does the absence of FCJ1 affect mitochondrial morphology?

When FCJ1 is absent (as in Δfcj1 cells), mitochondria exhibit dramatic morphological changes. The most notable effects include:

  • Complete lack of crista junctions

  • Formation of concentric stacks of inner membrane within the mitochondrial matrix

  • Increased levels of F₁F₀-ATP synthase supercomplexes

  • Altered mitochondrial function due to disrupted inner membrane organization

These morphological changes highlight the essential role of FCJ1 in maintaining proper mitochondrial architecture. The absence of CJs in Δfcj1 cells demonstrates that FCJ1 is not merely a regulator but is fundamentally required for CJ formation .

What are the optimal conditions for handling recombinant FCJ1 protein in laboratory settings?

When working with recombinant FCJ1 protein, several conditions must be carefully controlled to maintain protein stability and functionality:

  • Storage: Store the lyophilized powder at -20°C/-80°C upon receipt. After reconstitution, working aliquots can be stored at 4°C for up to one week, but long-term storage requires -20°C/-80°C temperatures .

  • Reconstitution: Briefly centrifuge the vial before opening to bring contents to the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add glycerol to a final concentration of 5-50% (preferably 50%) and aliquot for long-term storage .

  • Buffer conditions: The protein is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

  • Handling: Avoid repeated freeze-thaw cycles as this can significantly reduce protein activity. Thaw aliquots only once before use. When pipetting, use low-retention tips and minimize exposure to room temperature.

  • Experimental temperature: Most assays involving FCJ1 should be conducted at physiological temperatures (typically 25-30°C for yeast-based experiments or 37°C for mammalian systems), unless specifically investigating temperature-dependent effects.

What are the most effective techniques for studying FCJ1 localization and dynamics in mitochondria?

Several complementary techniques can be employed to study FCJ1 localization and dynamics:

  • Immunogold electron microscopy: This provides the highest resolution for localizing FCJ1 specifically to crista junctions. Fixed cells are sectioned and labeled with FCJ1-specific antibodies followed by gold-conjugated secondary antibodies.

  • Fluorescence microscopy with tagged FCJ1 variants: GFP-tagged or other fluorescently labeled FCJ1 constructs can be expressed to visualize its distribution within mitochondria. This approach allows for live-cell imaging and dynamics studies but must be validated to ensure the tag doesn't interfere with function.

  • Biochemical fractionation: Differential centrifugation and density gradient techniques can separate mitochondrial subcompartments, followed by Western blotting to detect FCJ1 in specific fractions .

  • SILAC (Stable Isotope Labeling with Amino acids in Cell culture) combined with affinity purification: This approach has been successfully used to identify FCJ1 interaction partners and can provide information about its molecular environment .

  • Super-resolution microscopy: Techniques like STED or PALM/STORM can resolve structures beyond the diffraction limit, allowing visualization of crista junctions (approximately 20-40 nm in diameter).

The choice of technique depends on the specific research question, with a combination of approaches often providing the most comprehensive understanding.

How do specific domains of FCJ1 contribute to its function in crista junction formation?

Research has identified several domains in FCJ1 with distinct functional roles:

  • Transmembrane domain: While specific amino acid sequences of the transmembrane segment are not critical, the presence of a transmembrane anchor is important for full functionality. Experiments with chimeric constructs where the transmembrane segment was replaced (e.g., FCJ1 Dld1-TM) showed that these variants could rescue mitochondrial morphology defects in Δfcj1 cells .

  • Coiled-coil domain (amino acids 166-342): Deletion of this domain (FCJ1 Δ166-342His) results in partial rescue of growth defects in Δfcj1 cells but doesn't fully restore CJ formation, suggesting this domain is important but not absolutely essential for function .

  • C-terminal domain: This is the most critical domain for FCJ1 function. Truncation experiments (FCJ1 1-472) showed that cells expressing FCJ1 lacking the C-terminal domain formed only about 9% of the normal number of CJs compared to wild-type FCJ1 . Additionally, this domain is required for genetic interaction with the F₁F₀ ATP synthase, highlighting its importance in the functional antagonism between FCJ1 and ATP synthase in determining cristae morphology.

This domain-specific contribution is summarized in the following table:

FCJ1 VariantRelative Number of CJs (%)Functional Properties
Fcj1 DLD1-TM68%Transmembrane domain replaced but functional
Fcj1 G52L124%Point mutation in transmembrane region, fully functional
Fcj1 Cyt b246%Alternative targeting sequence, partially functional
Fcj1 Δ166-342His4%Deletion of coiled-coil domain, severely impaired
Fcj1 1-4729%C-terminal truncation, severely impaired

These data demonstrate the crucial importance of the C-terminal domain for FCJ1's role in CJ formation .

What is known about the interaction between FCJ1 and the F₁F₀-ATP synthase in regulating cristae morphology?

FCJ1 and the F₁F₀-ATP synthase regulate cristae morphology through an antagonistic relationship:

This antagonistic relationship between FCJ1 and the F₁F₀-ATP synthase represents a fundamental mechanism for the regulation of mitochondrial cristae architecture, with important implications for mitochondrial function.

What are the best approaches for quantitatively analyzing changes in FCJ1 expression and CJ formation?

Several quantitative methods can be employed to analyze FCJ1 expression and CJ formation:

  • Quantitative proteomic analysis: SILAC-based quantitative proteomics can measure relative changes in FCJ1 abundance across different conditions or genetic backgrounds . This approach involves differential isotopic labeling of proteins, followed by mass spectrometry analysis.

  • Quantitative electron microscopy:

    • Count the number of CJs per mitochondrial section in electron micrographs

    • Measure CJ diameter using image analysis software

    • Quantify the frequency of cristae branching events

    This approach has been used to demonstrate that FCJ1 overexpression increases CJ numbers approximately 2-3 fold compared to control cells . Similarly, progressive down-regulation of FCJ1 leads to a corresponding decrease in CJ numbers .

  • Flow cytometry with fluorescently tagged FCJ1: This allows high-throughput measurement of FCJ1 expression levels across cell populations.

  • Quantitative RT-PCR: For measuring FCJ1 transcript levels in response to different treatments or genetic manipulations.

  • Computational modeling: Advanced image analysis algorithms can be used to reconstruct 3D models of mitochondrial ultrastructure from electron tomography data, allowing precise quantification of CJ dimensions and distribution.

For robust analysis, combining multiple approaches is recommended. For example, correlating changes in FCJ1 protein levels (by quantitative proteomics) with changes in CJ numbers (by electron microscopy) can provide mechanistic insights into the relationship between FCJ1 concentration and its functional effects.

How can researchers effectively investigate FCJ1 protein-protein interactions in mitochondrial membranes?

Investigating FCJ1 protein-protein interactions in mitochondrial membranes requires specialized approaches due to the hydrophobic nature of membrane proteins and the complex mitochondrial environment:

  • Affinity purification coupled with mass spectrometry (AP-MS): This approach has successfully identified FCJ1 interaction partners using protein A-tagged FCJ1 (FCJ1ProtA) as bait . The technique typically involves:

    • Solubilization of mitochondria with mild detergents like digitonin

    • Affinity chromatography using IgG beads to capture FCJ1ProtA and associated proteins

    • Mass spectrometric identification of co-purified proteins

  • SILAC-based quantitative proteomics: This enhances the specificity of AP-MS by allowing quantitative comparison between specific and non-specific interactions . Proteins specifically enriched in the FCJ1ProtA purification show high ratios of light to heavy peptides.

  • Proximity labeling methods: Techniques such as BioID or APEX2, where FCJ1 is fused to a promiscuous biotin ligase or peroxidase, can identify proteins in close proximity to FCJ1 in vivo.

  • Co-immunoprecipitation with membrane cross-linking: Chemical cross-linkers that can penetrate membranes (e.g., DSP or formaldehyde) can stabilize transient interactions before solubilization.

  • Genetic interaction screens: Systematic analysis of genetic interactions between FCJ1 and other genes can reveal functional relationships. For example, the genetic interaction between FCJ1 and ATP synthase subunit e provides evidence for their functional relationship .

  • Two-dimensional blue native/SDS-PAGE: This technique can resolve membrane protein complexes in their native state in the first dimension, followed by denaturing separation in the second dimension.

These approaches have revealed that FCJ1 interacts with various mitochondrial proteins, including components of protein import machinery and the TOB complex, providing insights into how CJs are positioned at the outer membrane .

How does FCJ1 from Pyrenophora tritici-repentis compare to homologs in other species?

FCJ1 from Pyrenophora tritici-repentis belongs to a family of evolutionary conserved proteins involved in mitochondrial cristae organization. While most detailed functional studies have been performed on the yeast Saccharomyces cerevisiae homolog (also called Fcj1) and the mammalian homolog (mitofilin/IMMT), several observations can be made about the P. tritici-repentis protein:

  • Structural conservation: The P. tritici-repentis FCJ1 protein (UniProt: B2WBQ6) shares the fundamental domain architecture with its homologs, including a transmembrane domain and conserved C-terminal region .

  • Functional conservation: Based on studies in yeast and mammals, it is likely that P. tritici-repentis FCJ1 performs similar functions in mitochondrial cristae organization. The conservation of this protein across diverse species suggests its fundamental importance in eukaryotic cell biology .

  • Species-specific adaptations: While the core function is likely conserved, fungi-specific features may exist that adapt the protein to the specific mitochondrial architecture and metabolic requirements of P. tritici-repentis as a plant pathogen.

  • Evolutionary context: P. tritici-repentis is an ascomycete fungus that causes tan spot disease in wheat . Understanding FCJ1's role in this organism may provide insights into mitochondrial function in plant pathogenic fungi.

Comparative genomic and proteomic analyses across species can further elucidate the evolutionary conservation and divergence of this important mitochondrial protein.

What is the significance of FCJ1 in the context of Pyrenophora tritici-repentis as a wheat pathogen?

The significance of FCJ1 in P. tritici-repentis pathogenicity remains an area for further research, but several hypotheses can be proposed based on current knowledge:

  • Metabolic adaptation: As a plant pathogen, P. tritici-repentis must adapt its metabolism during different infection stages. Mitochondrial function is central to cellular energy metabolism, and proper cristae organization (mediated by FCJ1) is essential for optimal respiratory efficiency. Therefore, FCJ1 may indirectly influence the pathogen's virulence by ensuring proper energy production during infection .

  • Stress response: Plant defense responses often include oxidative bursts that can damage fungal mitochondria. Properly organized cristae, maintained by FCJ1, may contribute to mitochondrial resilience against host-induced stress.

  • Potential connections to virulence factors: P. tritici-repentis produces several host-selective toxins, including ToxA, ToxB, and ToxC, which are important virulence factors . While direct links between FCJ1 and these toxins have not been established, mitochondrial function could influence the production or secretion of these effectors.

  • Fungicide targets: Understanding the structure and function of FCJ1 in P. tritici-repentis could potentially lead to the identification of novel fungicide targets that disrupt mitochondrial function in the pathogen.

Research in this area is still emerging, and direct experimental evidence linking FCJ1 to pathogenicity traits in P. tritici-repentis would be valuable for understanding the biological significance of this protein in the context of plant-pathogen interactions.

What techniques can be used to study the role of FCJ1 in Pyrenophora tritici-repentis mitochondrial function?

Studying FCJ1 in P. tritici-repentis requires specialized techniques adapted to this fungal pathogen:

  • Gene knockout or knockdown:

    • CRISPR-Cas9 gene editing to create FCJ1 deletion mutants

    • RNAi-based approaches for conditional knockdown

    • Analysis of resulting phenotypes including growth rate, sporulation, and pathogenicity

  • Microscopy techniques:

    • Transmission electron microscopy to visualize mitochondrial ultrastructure

    • Fluorescence microscopy with mitochondrial dyes (e.g., MitoTracker) combined with fluorescently tagged FCJ1

    • Live-cell imaging to monitor mitochondrial dynamics during different growth stages and infection processes

  • Biochemical approaches:

    • Isolation of mitochondria from P. tritici-repentis for functional studies

    • Membrane potential measurements to assess mitochondrial function

    • Respiratory chain activity assays to determine the impact of FCJ1 on bioenergetics

  • Proteomic analysis:

    • Mitochondrial proteome analysis in wild-type vs. FCJ1 mutants

    • Interaction studies to identify FCJ1 binding partners in P. tritici-repentis

    • Post-translational modification analysis

  • Pathogenicity assays:

    • Wheat infection studies comparing wild-type and FCJ1 mutant strains

    • Quantification of virulence factor production (e.g., ToxA, ToxB levels)

    • Host response analysis to determine if altered mitochondrial function affects host recognition

These approaches would need to be adapted to the specific challenges of working with P. tritici-repentis, including its growth requirements and genetic tractability.

How should researchers design experiments to study potential relationships between FCJ1 and virulence factors in Pyrenophora tritici-repentis?

Designing experiments to investigate potential relationships between FCJ1 and virulence factors requires a multi-faceted approach:

  • Genetic correlation studies:

    • Create FCJ1 deletion, partial deletion (domain-specific), and overexpression strains

    • Quantify expression levels of known virulence genes (ToxA, ToxB, toxb) in these genetic backgrounds

    • Conduct PCR tests with specific primers for effector genes in wild-type and FCJ1 mutant strains

  • Functional assays:

    • Compare secretion of virulence factors between wild-type and FCJ1 mutant strains

    • Test pathogenicity of mutant strains on differential wheat genotypes with known susceptibility patterns to specific toxins

    • Analyze host responses (necrosis, chlorosis) as indicators of toxin activity

  • Metabolic profiling:

    • Compare metabolic profiles of wild-type and FCJ1 mutant strains under different growth conditions

    • Focus on metabolic pathways that might influence toxin production

    • Measure ATP production and respiratory capacity as indicators of mitochondrial function

  • Microscopy and localization studies:

    • Investigate potential co-localization of FCJ1 with components of toxin production or secretion machinery

    • Examine ultrastructural changes in secretory pathways in FCJ1 mutants

  • Temporal expression analysis:

    • Monitor FCJ1 and virulence factor expression throughout infection stages

    • Look for temporal correlations that might suggest functional relationships

A sample experimental design table might look like this:

Experimental ApproachKey MethodsExpected OutcomesControls
FCJ1 knockout effects on virulenceCRISPR-Cas9 gene editing; wheat infection assaysChanges in pathogenicity, toxin productionWild-type strain; complemented mutant
FCJ1 expression during infectionqRT-PCR; Western blottingTemporal expression pattern of FCJ1 during infection processHousekeeping genes; non-pathogenic growth
Toxin quantification in FCJ1 mutantsELISA; bioassays on differential wheat linesCorrelation between FCJ1 function and toxin levelsKnown toxin producers/non-producers
Mitochondrial function assessmentOxygen consumption; membrane potentialImpact of FCJ1 on bioenergeticsChemical inhibitors of respiration

These approaches would help establish whether there are direct or indirect relationships between mitochondrial crista organization (mediated by FCJ1) and the pathogen's virulence mechanisms.

What are the most common technical challenges when working with recombinant FCJ1 protein, and how can they be addressed?

Researchers working with recombinant FCJ1 protein may encounter several technical challenges:

  • Protein solubility issues:

    • Challenge: As a membrane protein, FCJ1 can aggregate or form inclusion bodies during expression.

    • Solution: Optimize expression conditions (temperature, induction time, media composition); use solubility-enhancing fusion tags; explore different detergents for solubilization; consider expressing functional domains separately.

  • Protein stability and degradation:

    • Challenge: FCJ1 may be prone to degradation during purification or storage.

    • Solution: Include protease inhibitors during purification; optimize buffer conditions (pH, salt concentration); store with glycerol (5-50%) and avoid repeated freeze-thaw cycles ; aliquot protein solutions to minimize exposure to room temperature.

  • Functional assessment difficulties:

    • Challenge: Determining if the recombinant protein retains native function.

    • Solution: Develop in vitro assays for membrane binding or protein interaction; consider complementation assays in FCJ1-deficient cells; use structural probes to assess proper folding.

  • Protein quantification inaccuracies:

    • Challenge: Detergents or buffer components may interfere with protein quantification methods.

    • Solution: Use multiple quantification methods (BCA, Bradford, UV absorbance) and compare results; prepare standard curves in identical buffer conditions.

  • Reconstitution challenges:

    • Challenge: Difficult to reconstitute lyophilized protein without aggregation.

    • Solution: Follow recommended reconstitution protocols ; centrifuge vial before opening; use gentle mixing rather than vortexing; gradually dilute to working concentration.

  • Antibody specificity issues:

    • Challenge: Non-specific binding or poor recognition by antibodies.

    • Solution: Validate antibodies using positive and negative controls; consider using tagged versions of the protein for detection.

  • Storage and shipping problems:

    • Challenge: Loss of activity during storage or shipping.

    • Solution: Store lyophilized powder at -20°C/-80°C; maintain cold chain during shipping; validate protein activity after receipt .

Careful optimization of these parameters will help ensure successful experiments with recombinant FCJ1 protein.

How can researchers distinguish between direct and indirect effects when manipulating FCJ1 expression in experimental systems?

Distinguishing between direct and indirect effects of FCJ1 manipulation requires careful experimental design:

  • Use of domain-specific mutants:

    • Rather than complete knockouts, use domain-specific mutations or truncations to identify which protein regions are responsible for specific phenotypes.

    • The different functional outcomes of various FCJ1 variants (e.g., Fcj1 Δ166-342His vs. Fcj1 1-472) can help dissect direct from indirect effects .

  • Temporal control of expression:

    • Use inducible expression systems to observe immediate vs. delayed effects when FCJ1 is manipulated.

    • Immediate effects (within minutes to hours) are more likely to be direct consequences of FCJ1 function.

    • Time-course experiments with FCJ1 down-regulation have shown progressive loss of CJs, supporting a direct role in their formation .

  • Dose-dependency analysis:

    • Establish whether phenotypes show proportional responses to the level of FCJ1 expression.

    • Direct effects often show clear dose-dependency (e.g., the number of CJs correlates with FCJ1 expression levels) .

  • Rescue experiments:

    • Test whether wild-type FCJ1 can rescue phenotypes caused by FCJ1 deletion.

    • Test whether specific domains of FCJ1 can rescue distinct aspects of the phenotype.

    • For example, the observation that FCJ1 Δ166-342His partially rescues growth defects but not CJ formation suggests these are separable functions .

  • Isolation of genetic suppressors:

    • Identify mutations that suppress FCJ1 deletion phenotypes to reveal parallel or compensatory pathways.

  • Use of specific interacting partners:

    • Manipulate known FCJ1 interaction partners and compare phenotypes.

    • For example, examining the relationship between FCJ1 and F₁F₀-ATP synthase subunits helps distinguish direct effects on CJ formation from indirect effects on cristae morphology .

  • Correlation vs. causation analysis:

    • Use statistical approaches to distinguish correlative from causal relationships.

    • For example, the correlation between FCJ1 overexpression and increased CJ number, combined with the loss of CJs in FCJ1 deletion strains, strongly supports a causal relationship .

By combining these approaches, researchers can build a more robust understanding of which phenotypes are directly attributable to FCJ1 function versus those that arise as secondary consequences of altered mitochondrial architecture.

How should electron microscopy data be quantitatively analyzed to assess changes in mitochondrial cristae morphology related to FCJ1 function?

Quantitative analysis of electron microscopy data for assessing FCJ1-related changes in cristae morphology requires systematic approaches:

  • Sampling strategy:

    • Analyze multiple cells (typically 30-50) per condition to account for cell-to-cell variability

    • Examine multiple mitochondria per cell (10-20) to account for mitochondrial heterogeneity

    • Use random sampling methods to avoid selection bias

  • Key parameters to quantify:

    • Number of CJs per mitochondrial section

    • CJ diameter measurements

    • Frequency of cristae branching events

    • Cristae membrane surface area and volume

    • Distance between adjacent cristae

    • Angle of cristae relative to the mitochondrial longitudinal axis

  • Normalization methods:

    • Express CJ numbers relative to mitochondrial section area or perimeter

    • Normalize to wild-type controls, as seen in published data (e.g., Table 2 from reference )

    • Consider mitochondrial size and shape variations

  • Statistical analysis:

    • Use appropriate statistical tests (t-test, ANOVA) to determine significance

    • Report means with standard deviations or standard errors

    • Consider using non-parametric tests if data are not normally distributed

  • Advanced image analysis:

    • Employ semi-automated software for object recognition and measurement

    • Use 3D reconstruction from serial sections or electron tomography for volumetric analysis

    • Consider machine learning approaches for pattern recognition in cristae morphology

  • Presentation of results:

    • Include representative images alongside quantitative data

    • Use clear labeling of mitochondrial features (outer membrane, inner boundary membrane, cristae, CJs)

    • Present data in tables similar to Table 2 in reference , which shows relative numbers of CJs per mitochondrial section for different FCJ1 variants

  • Controls and validations:

    • Include both positive controls (wild-type) and negative controls (complete FCJ1 deletion)

    • Validate findings with complementary approaches (e.g., fluorescence microscopy of mitochondrial networks)

By applying these quantitative approaches consistently, researchers can objectively assess the impact of FCJ1 manipulations on mitochondrial ultrastructure.

What approaches should be used to resolve conflicting data about FCJ1 function or interactions?

When faced with conflicting data regarding FCJ1 function or interactions, researchers should employ several strategies:

  • Methodological assessment and standardization:

    • Compare experimental conditions, cell types, and methodologies between conflicting studies

    • Establish standardized protocols to eliminate method-based variability

    • Consider whether different solubilization methods might reveal different protein interactions

  • Genetic background analysis:

    • Determine if strain-specific genetic modifiers might influence FCJ1 function

    • Test FCJ1 variants in multiple genetic backgrounds

    • Consider the influence of mitochondrial DNA status (rho+/rho-/rho0) on observed phenotypes

  • Functional domain dissection:

    • Use domain-specific mutants to determine if apparent conflicts arise from different functional aspects of FCJ1

    • For example, differential effects of transmembrane domain vs. C-terminal domain mutations might explain some discrepancies

  • Quantitative rather than qualitative comparisons:

    • Replace binary (present/absent) assessments with quantitative measurements

    • For instance, quantify the degree of CJ reduction rather than simply noting their presence or absence

    • Use relative measurements as shown in Table 2 of reference , which can reveal subtle differences missed by qualitative observation

  • Temporal resolution:

    • Assess whether conflicting results might represent different time points in a dynamic process

    • Time-course experiments can reveal whether apparent contradictions reflect different stages of a progressive phenotype

  • Integration of multiple techniques:

    • Combine biochemical, genetic, and imaging approaches to build a more comprehensive picture

    • For example, correlate protein interaction data (from co-immunoprecipitation) with functional outcomes (from electron microscopy)

  • Meta-analysis approaches:

    • Systematically compare results across multiple studies

    • Identify patterns and consistent findings despite methodological differences

    • Calculate effect sizes to determine the strength of various FCJ1-related phenomena

  • Collaborative resolution:

    • Direct collaboration between labs with conflicting results

    • Exchange of materials (plasmids, strains, antibodies) to eliminate reagent-based variables

    • Blind analysis of samples to reduce unconscious bias

By systematically addressing potential sources of variability and integrating multiple lines of evidence, researchers can resolve apparent conflicts and develop a more nuanced understanding of FCJ1 function.

Future Research Directions

Future research should focus on elucidating the precise molecular mechanisms by which FCJ1, particularly its critical C-terminal domain, induces negative membrane curvature at crista junctions. Structural studies using cryo-electron microscopy could provide valuable insights into how FCJ1 interacts with lipids and other proteins to shape mitochondrial membranes. Additionally, investigating FCJ1's role in P. tritici-repentis pathogenicity could reveal connections between mitochondrial function and virulence factor production in this important wheat pathogen .

The development of more sophisticated in vitro systems to reconstitute crista junction formation using purified components would be a significant advance in understanding the minimal requirements for these complex membrane structures. Furthermore, comparative studies across different species could illuminate the evolutionary conservation and specialization of FCJ1 function in diverse organisms.

Implications for Broader Research Fields

The study of FCJ1 extends beyond basic mitochondrial biology, with implications for several broader research fields. In cell biology, understanding how FCJ1 contributes to mitochondrial compartmentalization provides insights into the fundamental principles of organelle structure and function. The mechanisms by which proteins like FCJ1 shape biological membranes have relevance for membrane biology in general.

In plant pathology, investigating the role of FCJ1 in P. tritici-repentis could contribute to our understanding of fungal bioenergetics during pathogenesis and potentially identify new targets for disease control strategies . The recombinant protein provides a valuable tool for studying these processes in vitro and for developing antibodies or other detection methods.

From a methodological perspective, the approaches developed to study FCJ1 and crista junctions contribute to the broader toolkit for investigating membrane protein function and mitochondrial ultrastructure. The integration of genetic, biochemical, and imaging techniques exemplified in FCJ1 research provides a template for comprehensive studies of other complex cellular structures.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.