Recombinant Pyrenophora tritici-repentis Solute carrier family 25 member 38 homolog (PTRG_00728)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Pyrenophora tritici-repentis Solute Carrier Family 25 Member 38 Homolog (PTRG_00728) is a protein produced through in vitro expression systems for research applications. Derived from the wheat tan spot fungus Pyrenophora tritici-repentis (strain Pt-1C-BFP), this protein belongs to the mitochondrial carrier family (SLC25), which typically facilitates the transport of metabolites, nucleotides, and cofactors across mitochondrial membranes .

Key identifiers:

  • UniProt ID: B2VSU4

  • Gene name: PTRG_00728

  • Protein length: 318 amino acids (full-length)

Comparative Analysis of SLC25 Homologs

PTRG_00728 shares homology with solute carrier proteins across fungi, plants, and animals.

Table 3: Homologs in Other Species

SpeciesGene IDFunctional Annotation
Aspergillus nigerANI_1_2744014Mitochondrial carrier protein
Saccharomyces cerevisiaeSCY_0799Solute carrier family 25 member 38 homolog
Homo sapiensSLC25A38Heme biosynthesis regulator
Mus musculusSlc25a38Appoptosin (apoptosis-related)

Research Applications and Limitations

While PTRG_00728’s specific role in P. tritici-repentis pathogenicity remains uncharacterized, its recombinant form serves as a tool for:

  • Functional studies: Investigating mitochondrial transport mechanisms in fungi.

  • Antibody development: Commercial antibodies target this protein for Western blot and immunofluorescence .

  • Comparative genomics: Studying SLC25 family evolution across taxa .

Notable gaps in research:

  • No direct link to P. tritici-repentis virulence factors (e.g., ToxA, ToxB) .

  • Structural or kinetic data for substrate specificity are unavailable.

Future Directions

Further studies could explore:

  • Cellular localization: Mitochondrial vs. cytoplasmic roles in P. tritici-repentis.

  • Pathogenicity assays: Knockout/overexpression experiments in fungal strains.

  • Structural biology: Cryo-EM or crystallography to resolve transport mechanisms.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you require a specific format, kindly indicate your preference when placing the order. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary based on your purchasing method and location. For specific delivery timeframes, please contact your local distributor.
Important: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us beforehand. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquotation at -20°C/-80°C. The default final glycerol concentration is 50%. This information can be used as a reference.
Shelf Life
The shelf life of our proteins is dependent on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. To maintain protein integrity, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
PTRG_00728; Mitochondrial glycine transporter; Solute carrier family 25 member 38 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Pyrenophora tritici-repentis (strain Pt-1C-BFP) (Wheat tan spot fungus) (Drechslera tritici-repentis)
Target Names
PTRG_00728
Target Protein Sequence
MSDGGKSSSSYFHFFAGLNSGILSAVLLQPADLLKTRVQQSRSSTLFGTIQSIASGPNPV RQFWRGTLPSTLRTGFGSAIYFSSLNALRHRASLGAAGRADAAAKGAEHSSSLPKLSNTA NLATGAFARTWAGFIMMPITVLKVRYESNLYAYNSLFTASRDIFRTEGLKGFFAGFGATA VRDAPYAGLYVLFYEQSKRKLSSLATKIEQTSGASTKLSTSTSAGINFVSGVAAAGLGTT ITNPFDAIKTRIQLMPERYGNMVQATKKMYMEEGLRCFFDGLGIRIARKAVSSALAWTLY EELIRRAETLKEVVEDKI
Uniprot No.

Target Background

Function
This mitochondrial glycine transporter facilitates the import of glycine into the mitochondrial matrix. It plays a crucial role in supplying glycine for the initial enzymatic step in heme biosynthesis. This step involves the condensation of glycine with succinyl-CoA to produce 5-aminolevulinate (ALA) within the mitochondrial matrix.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family, SLC25A38 subfamily
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Pyrenophora tritici-repentis and what significance does PTRG_00728 have in research?

Pyrenophora tritici-repentis (Ptr) is an ascomycete fungus that causes tan spot, a destructive foliar wheat disease that has become increasingly prevalent in wheat-growing regions worldwide, including Tunisia where it has shown increased frequency over the past decade . The fungus is also referred to as Drechslera tritici-repentis in some literature and is specifically known as the "wheat tan spot fungus" . PTRG_00728 is a gene that encodes a protein belonging to the Solute carrier family 25 member 38 homolog, which is of particular interest because SLC25 family proteins generally function as transport proteins located at the inner mitochondrial membrane . These proteins typically act as carriers for various metabolites, playing crucial roles in cellular metabolism and potentially in pathogenicity mechanisms . The study of PTRG_00728 may provide insights into the metabolic adaptations of Ptr during host infection and the molecular basis of its virulence, contributing to our understanding of host-pathogen interactions in this economically significant crop disease.

What are the structural characteristics of the PTRG_00728 protein?

The PTRG_00728 protein is characterized by a full-length sequence of 318 amino acids, with an expression region spanning positions 1-318 . Its amino acid sequence (MSDGGKSSSSYFHFFAGLNSGILSAVLLQPADLLKTRVQQSRSSTLFGTIQSIASGPNPVRQFWRGTLPSTLRTGFGSAIYFSSLNALRHRASLGAAGRADAAAKGAEHSSSLPKLSNTANLATGAFARTWAGFIMMPITVLKVRYESNLYAYNSLFTASRDIFRTEGLKGFFAGFGATAVRDAPYAGLYVLFYEQSKRKLSSLATKIEQTSGASTKLSTSTSAGINFVSGVAAAGLGTTITNPFDAIKTRIQLMPERYGNMVQATKKMYMEEGLRCFFDGLGIRIARKAVSSALAWTYEELIRRAETLKEVVEDKI) contains various functional domains typical of mitochondrial carrier proteins . The protein's structural features likely include multiple transmembrane domains that form a channel through the inner mitochondrial membrane, facilitating the transport of specific substrates. As a member of the SLC25 family, it likely shares the characteristic three-fold repeated structure with six transmembrane α-helices that is common among mitochondrial carrier proteins . This structural arrangement creates a channel through which specific metabolites can be transported between the mitochondrial matrix and the cytosol, suggesting a potential role in metabolic processes that might be critical for fungal virulence or survival during host infection.

What are the recommended storage and handling conditions for recombinant PTRG_00728?

The recombinant PTRG_00728 protein requires specific storage and handling conditions to maintain its stability and biological activity for research applications. According to manufacturer specifications, the recommended storage temperature is -20°C for regular storage, while extended storage should be at either -20°C or -80°C to preserve protein integrity . The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized specifically for this protein to enhance stability . For working with the protein, it is advisable to create aliquots to avoid repeated freezing and thawing cycles, which can degrade protein structure and function . These working aliquots can be stored at 4°C for up to one week without significant loss of activity . Researchers should take care when handling the protein to minimize exposure to room temperature and should work quickly on ice when preparing experimental samples. Additionally, it's important to note that the tag type used in the recombinant protein is determined during the production process and may vary between batches, which could potentially affect experimental approaches depending on the specific research application .

How does the PTRG_00728 homolog relate to pathogenicity mechanisms in Pyrenophora tritici-repentis?

The relationship between PTRG_00728 and Pyrenophora tritici-repentis pathogenicity requires examination within the context of the fungus's established virulence mechanisms. Ptr produces several effector proteins that contribute to its pathogenicity, including ToxA, ToxB, and ToxC, which induce necrosis and chlorosis in susceptible wheat genotypes . While no direct evidence currently links PTRG_00728 to these known effectors, as a member of the SLC25 family it may play an indirect role in pathogenicity by regulating metabolic processes critical for fungal growth and virulence . SLC25 proteins function as transporters at the inner mitochondrial membrane, facilitating the exchange of metabolites between the mitochondrial matrix and cytosol . This metabolic regulation could potentially support production of effector proteins or provide energy for infection processes. Research on other pathogenic fungi has shown that mitochondrial function and metabolism are often crucial for pathogenicity, suggesting that PTRG_00728 might contribute to Ptr virulence through similar mechanisms. Further research using knockout or knockdown studies of PTRG_00728 could help determine its specific contribution to pathogenicity, potentially revealing whether it affects the production or secretion of known effectors or influences other aspects of the infection process.

What experimental approaches are most effective for studying PTRG_00728 function in vivo?

Studying PTRG_00728 function in vivo requires a multi-faceted experimental approach that combines molecular genetics, biochemistry, and plant pathology techniques. Gene knockout or knockdown experiments represent a primary approach, where CRISPR-Cas9 or RNAi technology can be employed to eliminate or reduce PTRG_00728 expression in Pyrenophora tritici-repentis . Following genetic manipulation, researchers should conduct comprehensive phenotypic analyses comparing wildtype and mutant strains, including growth rate assessment, morphological characterization, and most importantly, pathogenicity assays on differential wheat genotypes . These assays should evaluate changes in virulence, infection efficiency, and symptom development (necrosis and chlorosis patterns). To ensure experimental validity, researchers must employ a between-subjects design with appropriate controls and sufficient biological replicates . Additionally, metabolomic approaches can reveal changes in metabolite profiles resulting from PTRG_00728 disruption, potentially identifying the specific substrates transported by this protein. Complementation studies, where the native gene is reintroduced into knockout mutants, are essential to confirm that observed phenotypes are specifically due to PTRG_00728 disruption rather than off-target effects . Finally, localization studies using fluorescent protein fusions can confirm the mitochondrial localization of PTRG_00728 and potentially reveal dynamic changes in its distribution during infection, providing further insights into its functional role.

What are the key considerations for designing experiments to study PTRG_00728 expression patterns?

Designing rigorous experiments to study PTRG_00728 expression patterns requires careful consideration of multiple factors to ensure valid and reproducible results. First, researchers must clearly define their specific research questions and formulate testable hypotheses regarding PTRG_00728 expression under various conditions, such as during different stages of fungal development or host infection . Variable selection is critical, with independent variables potentially including growth conditions, infection stages, or wheat genotypes with varying susceptibility, while the dependent variable would be PTRG_00728 expression levels . Researchers must identify and control potential confounding variables that could influence gene expression, including temperature, light conditions, media composition, and fungal strain genetic background . When designing treatment groups, a factorial design may be appropriate to examine interactions between multiple factors affecting PTRG_00728 expression, such as temperature and host genotype . Sample size determination should be based on power analysis, considering expected effect sizes and variability, to ensure sufficient statistical power to detect biologically meaningful differences in expression . Time-course experiments are particularly valuable for understanding dynamic changes in PTRG_00728 expression during infection processes, requiring careful consideration of appropriate sampling timepoints . Additionally, researchers should include appropriate reference genes for normalization when using RT-qPCR, selecting genes with stable expression across the experimental conditions being tested . Finally, biological replicates (independent fungal cultures or infections) and technical replicates (repeated measurements of the same biological sample) are essential to distinguish biological variation from measurement error .

What purification protocols are recommended for isolating recombinant PTRG_00728 protein for functional studies?

Purification of recombinant PTRG_00728 protein requires a carefully optimized protocol to obtain pure, active protein suitable for functional studies. The initial step involves selecting an appropriate expression system, with bacterial systems like E. coli being common for initial characterization, though eukaryotic systems may provide better folding for this mitochondrial protein . The protein's full-length sequence of 318 amino acids should be expressed with an affinity tag (determined during the production process) to facilitate purification . Following expression, cells should be harvested and lysed using techniques that preserve protein structure, such as gentle mechanical disruption or mild detergent lysis. The clarified lysate can then be subjected to affinity chromatography using a resin specific to the affinity tag, followed by size exclusion chromatography to remove aggregates and impurities . Throughout the purification process, a Tris-based buffer system containing 50% glycerol should be maintained as this has been optimized for PTRG_00728 stability . Researchers should monitor protein purity using SDS-PAGE and Western blotting at each purification step, with final purity assessment by mass spectrometry to confirm protein identity and integrity. Functional activity of the purified protein can be assessed through transport assays using reconstituted liposomes or mitochondrial incorporation experiments. The purified protein should be stored in small aliquots at -20°C or -80°C to prevent freeze-thaw degradation, with working stocks maintained at 4°C for up to one week as recommended . This meticulous approach ensures that downstream functional studies utilize protein that accurately represents native PTRG_00728 activity.

How can comparative genomics be applied to understand PTRG_00728 evolution and function?

Comparative genomics offers powerful approaches for elucidating the evolutionary history and potential functional roles of PTRG_00728 within the context of fungal pathogenicity. Researchers should begin by identifying homologs of PTRG_00728 across diverse fungal species, particularly focusing on plant pathogens with varying host specificities and virulence mechanisms . Multiple sequence alignment of these homologs can reveal conserved domains and motifs that likely correspond to functionally important regions of the protein, while also identifying species-specific variations that might relate to host adaptation or specialized functions . Phylogenetic analysis can reconstruct the evolutionary history of PTRG_00728, potentially revealing whether gene duplication, horizontal gene transfer, or accelerated evolution has occurred in particular lineages . Synteny analysis, examining the conservation of gene order surrounding PTRG_00728 across species, can provide insights into evolutionary dynamics and potential co-evolution with functionally related genes . Researchers should pay particular attention to correlation between PTRG_00728 sequence variants and pathogenicity patterns across fungal strains, similar to the analysis performed for ToxA, ToxB, and toxb genes in Ptr populations . Positive selection analysis can identify amino acid positions under selective pressure, potentially highlighting residues critical for protein function or host-pathogen interactions . Additionally, structural bioinformatics approaches can predict the three-dimensional structure of PTRG_00728 based on homology to characterized SLC25 family members, generating hypotheses about substrate binding sites and transport mechanisms . Integration of these comparative genomic data with transcriptomic and proteomic datasets can further illuminate the biological contexts in which PTRG_00728 functions, potentially revealing co-expression networks that suggest functional associations .

What statistical approaches are most appropriate for analyzing PTRG_00728 expression data?

Analyzing PTRG_00728 expression data requires appropriate statistical methods tailored to the experimental design and data characteristics. For comparing expression levels between two groups, such as infected versus uninfected samples, t-tests may be appropriate if the data meets assumptions of normality and equal variance; otherwise, non-parametric alternatives like the Mann-Whitney U test should be considered . For experiments involving multiple groups or factors, analysis of variance (ANOVA) is suitable, potentially including interaction terms to examine how different factors jointly influence PTRG_00728 expression . Time-course expression data, which would be valuable for understanding PTRG_00728 dynamics during infection, requires specialized approaches such as repeated measures ANOVA, mixed-effects models, or time series analysis methods . Regardless of the specific test, researchers should correct for multiple comparisons when analyzing expression across different conditions or timepoints, using methods such as Bonferroni correction or false discovery rate control to minimize Type I errors . Prior to statistical analysis, normalization of gene expression data is essential, particularly when using RT-qPCR, where reference genes must be carefully selected based on expression stability across experimental conditions . For RNA-seq data, appropriate normalization methods such as RPKM/FPKM or TMM should be applied to account for differences in sequencing depth and library composition . Correlation analyses can be valuable for examining relationships between PTRG_00728 expression and other variables such as fungal growth rate, effector production, or disease severity . Finally, multivariate techniques such as principal component analysis or hierarchical clustering can help identify patterns in complex datasets, potentially revealing co-regulated genes or expression signatures associated with specific biological processes .

What bioinformatic tools can researchers use to predict PTRG_00728 function and interactions?

Researchers have access to a diverse arsenal of bioinformatic tools to predict PTRG_00728 function and interactions, enabling hypothesis generation for subsequent experimental validation. Sequence-based tools like InterPro, Pfam, and SMART can identify conserved domains and motifs within PTRG_00728, providing initial functional annotations based on homology to characterized protein families . Structural prediction software including I-TASSER, AlphaFold2, and SWISS-MODEL can generate three-dimensional models of PTRG_00728 based on homology to solved structures of other SLC25 family members, offering insights into substrate binding pockets and transport mechanisms . Transmembrane topology prediction tools like TMHMM and Phobius are particularly relevant for this mitochondrial carrier protein, helping to identify membrane-spanning regions and orientation . For predicting protein-protein interactions, tools such as STRING, BioGRID, and PrePPI can identify potential interaction partners based on co-expression data, text mining, and structural compatibility . Metabolic pathway analysis tools including KEGG and MetaCyc can place PTRG_00728 within the context of fungal metabolic networks, suggesting potential substrates and metabolic roles . Sub-cellular localization prediction tools such as TargetP, MitoProt, and DeepLoc can confirm the mitochondrial targeting of PTRG_00728 and identify potential targeting sequences . Evolutionary analysis tools including PAML and HyPhy can detect signatures of selection in the PTRG_00728 sequence, potentially identifying functionally important residues under selective pressure . For transcriptional regulation analysis, tools like MEME, JASPAR, and TRANSFAC can identify potential regulatory elements in the PTRG_00728 promoter region. Integration of these various predictive approaches, combined with experimental validation of key predictions, provides a comprehensive strategy for elucidating PTRG_00728 function and its role in Pyrenophora tritici-repentis biology.

What are the most promising approaches for determining PTRG_00728 substrate specificity?

Determining PTRG_00728 substrate specificity represents a critical research direction that would significantly advance our understanding of its function in Pyrenophora tritici-repentis biology. A multi-faceted approach combining in vitro biochemical assays, in vivo functional studies, and computational predictions offers the most promising strategy. Recombinant protein expression and purification, as described in the product specifications, provides the foundation for direct biochemical characterization . The purified protein could be reconstituted into liposomes or proteoliposomes to create an experimental system for transport assays, where potential substrates are systematically tested for transport activity. Isotope labeling of candidate substrates would allow sensitive detection of transport events using techniques such as scintillation counting or mass spectrometry. Complementary approaches include structural studies such as X-ray crystallography or cryo-electron microscopy, which could reveal binding pocket architecture and substrate coordination residues . In parallel, targeted mutagenesis of conserved residues predicted to line the translocation pathway could identify amino acids critical for substrate recognition and transport, providing further insights into specificity determinants . Computational approaches including molecular docking and molecular dynamics simulations with candidate substrates can generate testable hypotheses about substrate preferences . In vivo approaches, such as metabolomic profiling of wildtype versus PTRG_00728 knockout mutants, could reveal metabolites that accumulate or become depleted when the transporter is absent, indirectly indicating potential substrates . Given the typical role of SLC25 family members in transporting metabolites across the inner mitochondrial membrane, researchers should prioritize testing mitochondrial-related metabolites including nucleotides, amino acids, carboxylates, and cofactors that might be relevant to fungal energy metabolism or biosynthetic pathways active during host infection .

What role might PTRG_00728 play in fungal adaptation to environmental stresses during infection?

PTRG_00728's potential role in fungal adaptation to environmental stresses during infection represents an intriguing area for future investigation. As a mitochondrial carrier protein, PTRG_00728 likely contributes to metabolic flexibility, which is crucial for adaptation to the changing conditions encountered during the infection process . The wheat leaf environment presents numerous stresses to invading Pyrenophora tritici-repentis, including oxidative stress from host defense responses, nutrient limitations, and fluctuating temperature and humidity conditions . SLC25 family proteins generally facilitate the exchange of metabolites between mitochondrial and cytosolic compartments, potentially allowing rapid metabolic adjustments in response to these stresses . To investigate this hypothesis, researchers could analyze PTRG_00728 expression under various stress conditions in vitro, such as oxidative stress, nutrient limitation, or temperature shifts, to determine whether its regulation responds to these environmental challenges . Additionally, comparing the stress tolerance of wildtype and PTRG_00728 mutant strains could reveal specific conditions where this transporter becomes critical for fungal survival or growth . Metabolomic comparisons between wildtype and mutant strains under stress conditions could identify specific metabolic pathways that depend on PTRG_00728 function, potentially revealing its contribution to stress adaptation mechanisms . Given that fungal effector production and virulence are often regulated in response to environmental cues, researchers should also investigate whether PTRG_00728 function influences the expression or activity of known virulence factors like ToxA and ToxB under stress conditions . Understanding PTRG_00728's role in stress adaptation could provide valuable insights into fungal pathogenicity mechanisms and potentially identify new targets for disease control strategies that exploit metabolic vulnerabilities in the pathogen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.