Recombinant Pyrenophora tritici-repentis Vacuolar ATPase assembly integral membrane protein VMA21 (vma21)

Shipped with Ice Packs
In Stock

Description

Functional Role in V-ATPase Assembly

V-ATPase consists of a cytosolic V1 sector (ATP hydrolysis) and a membrane-embedded V0 sector (proton translocation). Recombinant VMA21 facilitates V0 assembly by:

  • Subunit Coordination: Acting as an endoplasmic reticulum (ER)-localized chaperone to recruit proteolipid subunits (e.g., Vma11p) and the 100-kDa subunit Vph1p .

  • ER Export: Packaging assembled V0 into COPII vesicles for Golgi transport, mediated by its ER-retrieval motif (-KKXX) .

  • Quality Control: Preventing premature binding of V1 to V0, ensuring functional V-ATPase activation only in target organelles .

Key Mutational Effects:

  • R18G/D63G/G91A: Disrupt interactions with V0 subunits (e.g., ATP6V0C) and assembly factor ATP6AP2, impairing lysosomal acidification .

  • KKXX motif deletion: Misroutes VMA21 to vacuoles but retains partial V-ATPase activity .

Mechanistic Studies

  • Yeast Models: Used to dissect V0 assembly kinetics and ER-Golgi trafficking .

  • Lipid Metabolism: Links VMA21 dysfunction to autophagic vacuolar myopathy and hepatic steatosis via impaired lysosomal lipolysis .

Disease Relevance

  • X-Linked Myopathy: Hypomorphic VMA21 mutations reduce V0 stability, causing autolysosomal lipid accumulation in muscle and liver cells .

  • Glycosylation Defects: Impaired V-ATPase activity leads to abnormal protein glycosylation and elevated LDL cholesterol in hepatocytes .

Table 2: Clinical Phenotypes Associated with VMA21 Deficiency

PhenotypeCellular MechanismAffected Systems
Chronic hypertransaminasemiaLysosomal dysfunction in hepatocytesLiver
Autophagic myopathyLipid droplet accumulation in muscleSkeletal muscle

Comparative Insights Across Species

While Saccharomyces cerevisiae Vma21p is well-characterized, recombinant P. tritici-repentis VMA21 shares:

  • Conserved Assembly Role: ER retention and V0 subunit recruitment .

  • Structural Divergence: Fungal-specific residues in the N-terminal domain may optimize interactions with pathogen-specific V0 subunits .

Future Directions

  • Therapeutic Targeting: Small molecules stabilizing VMA21-V0 interactions could ameliorate V-ATPase deficiencies .

  • Agricultural Relevance: Engineering VMA21 variants may disrupt fungal V-ATPase function, offering novel antifungal strategies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
vma21; PTRG_07997; Vacuolar ATPase assembly integral membrane protein vma21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Pyrenophora tritici-repentis (strain Pt-1C-BFP) (Wheat tan spot fungus) (Drechslera tritici-repentis)
Target Names
vma21
Target Protein Sequence
MTTRRIVTSEKSTLDYDGKGAPEPSNTSPAVPSSVIWKLMSFTFAMITLPIGTYFFTVNW VFQGNATYAGGLAALMANVVLIAYVIMAFRDDQEEMREEAEKSKKKL
Uniprot No.

Target Background

Function
VMA21 is essential for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum.
Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Q&A

What is the relationship between Pyrenophora tritici-repentis and the V-ATPase assembly protein VMA21?

The relationship between these two research areas represents an intersection of plant pathology and molecular cell biology. Pyrenophora tritici-repentis (Ptr) is a necrotrophic fungal pathogen causing tan spot disease in wheat, while VMA21 is a critical assembly factor for vacuolar H+-ATPases. Although they represent distinct biological systems, both involve protein trafficking, cellular compartment acidification, and regulated protein expression systems that are essential for their respective functions. Both can be studied using recombinant protein technology, particularly through heterologous expression systems like E. coli SHuffle and Pichia pastoris . Understanding how fungal pathogens like Ptr might interact with or influence host cellular processes involving V-ATPase functionality represents an emerging field of research in plant-pathogen interactions.

What are the most efficient expression systems for recombinant Pyrenophora tritici-repentis proteins and VMA21?

For Ptr effector proteins (ToxA and ToxB), the E. coli SHuffle system has demonstrated superior results compared to Pichia pastoris. The SHuffle system generates higher yields of soluble and stable recombinant proteins. Specifically:

Expression SystemProteinYieldNotes
E. coli SHuffleToxB (without signal peptide)79.6 μg/mlHighly soluble
E. coli SHuffleToxA3.2 μg/mlLower yield
E. coli BL21ToxB5 mg/LRequires in vitro refolding
P. pastorisToxA/ToxBVariableCauses non-specific chlorosis due to co-purified glucanases

For VMA21, mammalian expression systems have been used successfully, with transient transfection in HEK293T cells allowing for adequate expression of wild-type and mutant VMA21 proteins for interaction studies .

Key methodological considerations include:

  • Removing native signal peptides significantly increases protein yield in bacterial systems

  • C-terminal histidine tags can interfere with ToxA functionality

  • Codon optimization may be necessary for optimal expression

How is VMA21 function assessed in experimental systems?

VMA21 function can be assessed through several complementary approaches:

  • V-ATPase assembly assessment via Western blot analysis:

    • Measuring steady-state levels of V₀ subunits (ATP6V0D1, ATP6V0C)

    • Reduced V₀ subunit expression indicates impaired V-ATPase assembly

  • Protein interaction studies:

    • Co-immunoprecipitation to assess interaction between VMA21 and V₀ subunits

    • Evaluating binding to assembly factors like ATP6AP2

  • Yeast functional complementation assays:

    • Growth in media containing elevated zinc concentrations

    • Functional VMA21 rescues growth under these conditions

    • Mutant VMA21 variants show impaired rescue capability

  • Lysosomal acidification measurements:

    • LysoSensor - fluorescent dye with pH-dependent intensity

    • LysoTracker - labels acidic compartments

    • Reduced fluorescent punctae indicate acidification defects

  • Animal models (zebrafish):

    • CRISPR-Cas9 generated vma21 mutants

    • Assessment of swim behavior, survival, and autophagy markers

    • Response to autophagy modulators

These methods provide a comprehensive evaluation of how VMA21 variants affect V-ATPase assembly and function.

What mechanisms underlie the host-selective toxicity of Pyrenophora tritici-repentis effectors?

The host-selective toxins (HSTs) of P. tritici-repentis, particularly ToxA and ToxB, induce susceptibility in wheat through sophisticated mechanisms:

  • Activation of defense-like responses:

    • Upregulation of WRKY transcription factors

    • Induction of receptor-like kinases (RLKs) and pathogenesis-related (PR) proteins

    • Activation of phenylpropanoid and jasmonic acid pathways

  • Common mechanisms between ToxA and ToxB:

    • ROS (reactive oxygen species) accumulation

    • Photosystem dysfunction

    • Altered bioenergetics and metabolic pathways

  • Key differences between toxins:

    • ToxA induces faster transcriptional and biochemical responses

    • ToxA specifically activates ethylene biosynthesis

    • Symptom development occurs more rapidly with ToxA

  • Metabolic reprogramming:

    • Alterations in flavonoid metabolism

    • Changes in sugar metabolism, glycolysis and glucogenesis

    • Shifts in chloroplast and photosynthetic machinery, especially pronounced in susceptible cultivars at later timepoints

This research supports the hypothesis that necrotrophic fungi like Ptr exploit host defense responses to induce cell death, creating favorable conditions for pathogen growth and reproduction. The molecular details of this "hijacking" mechanism represent a fascinating example of pathogen-host co-evolution .

How do mutations in VMA21 affect V-ATPase assembly and cellular function?

VMA21 mutations impact V-ATPase assembly and cellular function through multiple mechanisms:

Cellular ProcessEffect of VMA21 MutationExperimental Evidence
Lysosomal acidificationSeverely reducedDecreased LysoSensor and LysoTracker signal
Protease activationImpairedReduced proteolytic activity
AutophagyDysfunctionalAccumulation of autophagic vacuoles, altered LC3 levels
Lipid metabolismDefective lipophagyEnlarged lipid droplet-containing autolysosomes
Survival (in zebrafish)ReducedDecreased lifespan in mutant models

These findings illuminate how VMA21 deficiency disrupts fundamental cellular processes through impaired acidification of intracellular compartments .

What are the technical challenges in heterologous expression of recombinant proteins with signal peptides?

Signal peptides pose significant challenges for recombinant protein expression in heterologous systems:

  • Challenges in E. coli expression systems:

    • Native eukaryotic signal peptides often reduce protein yield

    • Signal peptides can lead to protein instability and aggregation

    • For ToxB, inclusion of signal peptide resulted in lower yield and anomalous banding patterns

  • System-specific compatibility issues:

    • Eukaryotic signal peptides may be poorly recognized by bacterial secretion machinery

    • Codon usage differences between source organism and expression host

    • Potential for improper folding or premature degradation

  • Methodological solutions:

    • Express proteins without native signal peptides for maximum yield

    • If secretion is necessary, optimize codon usage of signal peptides

    • Consider adding bacterial signal sequences optimized for the expression host

    • Evaluate different leader sequences to identify optimal combinations

  • Advanced optimization strategies:

    • Developing synthetic signal peptides that function efficiently across kingdoms

    • Systematic testing of signal peptide libraries

    • Computational design of signal sequences compatible with heterologous hosts

Researchers have reported that expressing Ptr toxins without signal peptides in the E. coli SHuffle system provides optimal results, with yields up to 16 times higher than alternative approaches .

How can animal models contribute to understanding VMA21-related disorders?

Zebrafish models have emerged as valuable tools for studying VMA21-related disorders:

  • Generation and validation of zebrafish models:

    • CRISPR-Cas9 editing targeting exon 2 of zebrafish vma21

    • Two distinct loss-of-function mutations: Δ1 (1bp deletion) and Δ14ins21 (14bp deletion with 21bp insertion)

    • Confirmation of reduced Vma21 protein levels by Western blot (Fig. 1C,D in source material)

  • Phenotypic characterization:

    • Motor function: Impaired swim behavior and touch-evoked escape response

    • Survival: Significantly reduced lifespan

    • Liver function: Hepatic steatosis, smaller liver size, impaired bile flux

    • Autophagy markers: Lysosomal de-acidification, characteristic autophagic vacuoles in muscle fibers, altered LC3 levels

  • Therapeutic insights from the model:

    • Two compounds (edaravone and LY294002) improved multiple disease parameters:

      • Enhanced birefringence (indicator of muscle integrity)

      • Improved motor function

      • Extended survival

    • Multiple autophagy modulators ameliorated aspects of the phenotype

    • Supports the critical role of autophagy in disease pathogenesis

  • Translational value:

    • First animal model of X-linked myopathy with excessive autophagy (XMEA)

    • Platform for high-throughput drug screening

    • System for detailed mechanistic studies of disease progression

    • Tool for evaluating potential therapeutic strategies

The zebrafish vma21 mutant accurately recapitulates key aspects of human VMA21-related disorders and provides valuable opportunities for therapeutic development.

What are the differences in host responses induced by ToxA versus ToxB in susceptible wheat cultivars?

Comparative analysis of ToxA and ToxB-induced responses in susceptible wheat cultivars reveals both similarities and important differences:

  • Shared transcriptional responses:

    • Activation of WRKY transcription factors

    • Induction of receptor-like kinases (RLKs)

    • Upregulation of pathogenesis-related (PR) proteins

    • Enhanced expression of phenylpropanoid and jasmonic acid pathway components

  • Common physiological mechanisms:

    • ROS accumulation in affected tissues

    • Dysfunction of photosynthetic machinery

    • Alterations in cellular redox status

  • Key differences in response kinetics:

    • ToxA induces more rapid transcriptional changes

    • ToxA triggers faster biochemical responses

    • Symptom development (necrosis) occurs more quickly with ToxA compared to ToxB (chlorosis)

  • Toxin-specific pathway activation:

    • ToxA specifically activates ethylene biosynthesis pathways

    • ToxB shows differential effects on certain metabolic processes

    • Perception mechanisms appear to differ between the two toxins

  • Visual symptomatology:

    • ToxA: Necrotic lesions (cell death)

    • ToxB: Chlorotic symptoms (yellowing without immediate cell death)

These differences likely reflect distinct evolutionary adaptations by the pathogen to manipulate host responses through multiple mechanisms, potentially enhancing its ability to infect a wider range of wheat genotypes.

How can researchers quantify the effects of VMA21 mutations on lysosomal function?

Researchers can employ several complementary techniques to quantify the effects of VMA21 mutations on lysosomal function:

  • Lysosomal acidification assays:

    • LysoSensor: pH-sensitive fluorescent dye that emits stronger fluorescence at lower pH

    • LysoTracker: Selectively accumulates in acidic compartments

    • Quantification parameters: Number of positive punctae, fluorescence intensity, distribution pattern

  • V-ATPase assembly and function analysis:

    • Western blot quantification of V₀ subunits (ATP6V0D1, ATP6V0C)

    • Co-immunoprecipitation to assess protein-protein interactions

    • Yeast complementation assays with growth on elevated zinc media

  • Autophagy flux measurements:

    • LC3-I to LC3-II conversion (Western blot)

    • p62/SQSTM1 accumulation

    • Tandem fluorescent-tagged LC3 (mRFP-GFP-LC3) for measuring autophagosome-lysosome fusion

  • Electron microscopy analysis:

    • Quantification of autophagic vacuoles

    • Measurement of vacuole size and morphology

    • Assessment of electron-dense materials within vacuoles

  • Functional consequences assessment:

    • Proteolytic activity assays using fluorescent substrates

    • Glycosylation analysis of hepatocyte-derived proteins

    • Lipid droplet accumulation and lipophagy assessment

    • Biliary function tests in animal models

These methodologies provide a comprehensive framework for characterizing how VMA21 mutations affect lysosomal function and related cellular processes.

What are the current hypotheses regarding the exploitation of host defense responses by necrotrophic fungi?

Current research supports several interconnected hypotheses regarding how necrotrophic fungi like Pyrenophora tritici-repentis exploit host defense responses:

  • Inverse gene-for-gene model:

    • Unlike biotrophic pathogens where resistance is conferred by recognition

    • In necrotrophic interactions, recognition leads to susceptibility

    • Effectors (ToxA, ToxB) interact with host targets to trigger cell death pathways

  • Defense response hijacking mechanisms:

    • Activation of ROS production normally used against biotrophs

    • Induction of phenylpropanoid and jasmonic acid pathways

    • Triggering of hypersensitive-like responses that benefit necrotrophs

  • Photosystem targeting strategy:

    • Both ToxA and ToxB cause photosystem dysfunction

    • Disruption of chloroplast functions leads to energy crisis

    • Metabolic shifts in flavonoid metabolism and sugar pathways contribute to disease progression

  • Metabolic manipulation hypothesis:

    • Ptr toxins alter host metabolism to favor pathogen nutrition

    • Key pathways affected include starch and sucrose metabolism

    • Flavone and flavonol biosynthesis emerge as critical processes in susceptibility

  • Multi-layered susceptibility model:

    • Distinct but overlapping mechanisms for different toxins

    • Temporal differences in response induction (ToxA faster than ToxB)

    • Combinatorial effects when multiple effectors are present

These hypotheses collectively suggest that necrotrophic fungi have evolved sophisticated strategies to convert plant defense machinery into susceptibility factors, representing a fascinating example of pathogen-host co-evolution .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.