Recombinant Pyrobaculum aerophilum Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Pyrobaculum aerophilum CobS

Recombinant Pyrobaculum aerophilum cobalamin synthase (CobS) is a thermostable enzyme critical for the final steps of cobalamin (vitamin B12) biosynthesis. CobS catalyzes the condensation of adenosylcobinamide-GDP (AdoCbi-GDP) and α-ribazole-phosphate (α-RP) to form adenosylcobalamin-5′-phosphate (AdoCbl-P), a precursor to active coenzyme B12 . This enzyme is essential for organisms requiring B12-dependent metabolic pathways, particularly under extreme environmental conditions.

Enzymatic Activity and Mechanism

CobS operates in the late stages of cobalamin biosynthesis:

  1. Substrates: AdoCbi-GDP (activated cobinamide) and α-RP (activated lower ligand) .

  2. Reaction:

    AdoCbi-GDP+α-RPCobSAdoCbl-P+GDP\text{AdoCbi-GDP} + \alpha\text{-RP} \xrightarrow{\text{CobS}} \text{AdoCbl-P} + \text{GDP}
  3. Product: AdoCbl-P, which is dephosphorylated by CobC to yield active AdoCbl .

Key Findings:

  • Overexpression of CobS in E. coli disrupts membrane potential due to incomplete substrate processing, highlighting the necessity of co-expressing CobC (phosphatase) and PspA (phage shock protein) for functional assembly .

  • Recombinant CobS exhibits strict substrate specificity for GDP-linked cobinamide derivatives .

Recombinant Expression and Purification

Recombinant P. aerophilum CobS is typically produced in E. coli with an N-terminal hexahistidine (His6) tag for affinity purification .

ParameterDetail
Expression HostE. coli BL21(DE3)
VectorpET17b with NheI/BamHI cloning sites
InductionIPTG (1 mM) at 37°C
PurificationNi-NTA chromatography under denaturing/native conditions
Yield~15–20 mg/L culture (estimated from homologous systems)

Challenges:

  • Solubility issues in mesophilic hosts require optimization of induction temperatures and buffer conditions .

  • Co-expression with chaperones (e.g., GroEL/ES) improves folding efficiency .

Role in Cobalamin Biosynthesis

  • CobS is indispensable for de novo cobalamin synthesis in archaea, linking corrinoid assembly to cofactor activation .

  • In vitro studies confirm CobS activity is Mg²⁺-dependent, with optimal activity at pH 7.0–8.0 .

Applications in Biotechnology

  • Enzyme Engineering: Thermostable CobS is a candidate for industrial B12 production under high-temperature bioprocessing .

  • Metabolic Engineering: Heterologous expression in E. coli enables synthetic pathways for corrinoid derivatives .

Comparative Analysis with Homologs

OrganismCobS FeatureThermostabilityReference
E. coliRequires CobC for product dephosphorylationModerate (≤37°C)
Pyrobaculum calidifontis92% sequence identity to P. aerophilum CobSExtreme (≤100°C)
Rhodobacter sphaeroidesUtilizes CbiZ for cobamide remodelingModerate (≤30°C)

Future Directions

  • Structural Studies: X-ray crystallography of recombinant CobS would elucidate substrate-binding dynamics .

  • Industrial Scale-Up: Engineering E. coli strains with thermotolerant CobS could enhance B12 yields .

  • Environmental Relevance: Investigating CobS in extreme ecosystems may reveal novel corrinoid biosynthesis pathways .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cobS; PAE0379; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827)
Target Names
cobS
Target Protein Sequence
MRCLKSLLAFFTAFPIGGAELSFKCVWALPYVAAPIIAAIPTTLLYLGASPAIAYIALLA ATGLHHLDGLADVGDALLVRDREAARRVLEDPRRGTGGIFAVTAVVVTTAAHLHSPLQLL LGEVFSKSTALLFAGFSKSFKPGLGEAFTEAAKRQWPAALPALAVLAYLAPVTTAVSLAT SALLYQLAYRHLGGANGDVYGYLLEVSRSAFVIWSAYVPVPTAF
Uniprot No.

Target Background

Function

Recombinant Pyrobaculum aerophilum Cobalamin Synthase (CobS) catalyzes the synthesis of adenosylcobalamin (Ado-cobalamin) from adenosylcobinamide-GDP and α-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and α-ribazole 5'-phosphate.

Database Links

KEGG: pai:PAE0379

STRING: 178306.PAE0379

Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Pyrobaculum aerophilum and what makes it a significant organism for studying cobalamin synthase?

Pyrobaculum aerophilum is a hyperthermophilic crenarchaeon with an optimal growth temperature of 100°C, making it one of the most thermophilic organisms known to possess an aerobic respiratory chain . This extremophile thrives in high-temperature environments, which means its proteins, including Cobalamin synthase (cobS), have evolved unique adaptations for thermostability. The thermostable nature of enzymes from this organism makes them particularly valuable for studying protein stability mechanisms and for biotechnological applications requiring heat-resistant enzymes. P. aerophilum's cobalamin synthase represents an opportunity to understand how critical metabolic pathways function under extreme conditions, providing insights into the evolution and adaptation of vitamin B12 biosynthesis across domains of life .

What is the function of Cobalamin synthase (cobS) in cellular metabolism?

Cobalamin synthase (cobS) plays a crucial role in the biosynthesis of vitamin B12 (cobalamin), specifically in the assembly of the nucleotide loop of the cobalamin molecule. The enzyme catalyzes one of the final steps in cobalamin biosynthesis, contributing to the formation of the complete cobamide structure. Cobalamin is an essential cofactor for several key metabolic enzymes involved in methylation reactions, isomerization processes, and nucleotide reduction. In archaea like Pyrobaculum aerophilum, cobS is particularly important for maintaining these essential metabolic functions under extreme environmental conditions. The enzyme's activity ensures the availability of functional cobalamin for methionine synthase and other B12-dependent enzymes, which are critical for various cellular processes including amino acid metabolism and DNA synthesis .

How does P. aerophilum cobS compare to cobS enzymes from other organisms?

While the search results don't provide direct comparative data for cobS across species, we can draw some inferences based on what we know about proteins from hyperthermophiles. P. aerophilum cobS likely contains adaptations that allow it to function at extremely high temperatures (around 100°C), unlike mesophilic cobS enzymes. These adaptations typically include a higher proportion of charged amino acids forming salt bridges, increased hydrophobic interactions in the protein core, and fewer thermolabile residues.

Comparing to the cobamide remodeling process studied in other organisms, P. aerophilum might utilize distinct mechanisms. For instance, in Akkermansia muciniphila, a novel enzyme called CbiR (rather than the canonical CbiZ) hydrolyzes the phosphoribosyl bond in cobamides . P. aerophilum may have evolved unique pathways or enzyme modifications for cobalamin synthesis under extreme conditions, potentially different from both the CbiZ-dependent pathways in Rhodobacter sphaeroides and the CbiR pathway in A. muciniphila .

What are the optimal culture conditions for growing Pyrobaculum aerophilum for cobS expression studies?

P. aerophilum requires specialized culture conditions due to its hyperthermophilic nature. The organism should be grown anaerobically in media containing:

  • 0.5 g/L yeast extract

  • 1× DSM390 salts

  • 10 g/L NaCl

  • 1× DSM 141 trace elements

  • 0.5 mg/L Fe(SO₄)₂(NH₄)₂

  • pH 6.5

  • 10 mM NaNO₃ as electron acceptor

Cultures should be maintained at 95°C until late log or stationary phase, monitored by measuring optical density at 600 nm. For anaerobic conditions, media should be prepared under nitrogen with resazurin (0.5 mg/L) as a redox indicator, and 0.25 mM Na₂S added as a reductant . These conditions provide the optimal environment for P. aerophilum growth and subsequent protein expression, ensuring proper folding and activity of the thermostable cobS enzyme.

What expression systems are most effective for producing recombinant P. aerophilum cobS?

While the search results don't specifically address expression systems for P. aerophilum cobS, we can extrapolate from related research on other P. aerophilum proteins. Expression of archaeal proteins in E. coli has been successfully demonstrated with the Rieske iron-sulfur protein from P. aerophilum . For cobS expression, the following approach would be recommended:

  • Codon-optimization of the cobS gene (PAE0379) for E. coli expression

  • Cloning into a vector with a strong inducible promoter (e.g., T7 promoter-based systems)

  • Addition of appropriate affinity tags (His-tag or MBP-tag) to facilitate purification

  • Expression in E. coli strains designed for protein expression (e.g., BL21(DE3))

  • Induction at lower temperatures (16-25°C) to allow proper folding

  • Extended expression times to accommodate the complex folding of archaeal proteins

From experience with other P. aerophilum proteins, it's known that soluble, thermostable proteins with correctly inserted cofactors can be expressed from appropriately designed constructs in E. coli .

What purification strategy yields the highest activity for recombinant cobS?

Based on information about related proteins, a multi-step purification strategy would be recommended for obtaining high-activity recombinant cobS:

  • Heat treatment (70-80°C for 15-30 minutes) to eliminate most E. coli proteins while preserving the thermostable cobS

  • Affinity chromatography using the engineered tag (e.g., His-tag with Ni-NTA resin)

  • Size exclusion chromatography to remove aggregates and obtain homogeneous protein

  • Ion exchange chromatography for final polishing if needed

The optimal buffer system would likely contain:

  • 50 mM Tris or phosphate buffer at pH 7.0-8.0

  • 150-300 mM NaCl to maintain solubility

  • 10% glycerol as a stabilizing agent

  • 1-5 mM reducing agent (DTT or β-mercaptoethanol)

Storage should be at -20°C or -80°C in a buffer containing 50% glycerol, as recommended for the commercially available recombinant protein . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided .

What cofactors and reaction conditions are required for optimal cobS enzymatic activity?

Based on information about related cobamide-processing enzymes and the nature of the reaction catalyzed by cobS, the following cofactors and conditions would likely be required for optimal activity:

Cofactors:

  • Divalent metal ions (likely Mg²⁺ or Mn²⁺) for catalysis

  • Potentially ATP as an energy source for the reaction

Optimal Reaction Conditions:

  • Temperature: 85-100°C (reflecting the hyperthermophilic nature of P. aerophilum)

  • pH: 6.5-7.5 (based on optimal growth conditions for the organism)

  • Reducing environment (to maintain thiol groups in the enzyme)

  • Absence of oxygen (anaerobic conditions) to prevent oxidative damage

For experimental assays, activity could be monitored through the formation of complete cobamide products using HPLC analysis with UV-Vis detection, similar to methods used for studying cobamide remodeling enzymes .

How does the thermostability of P. aerophilum cobS compare to other cobS enzymes from mesophilic organisms?

While specific comparative data is not provided in the search results, insights can be drawn from studies of other proteins from P. aerophilum, such as the Rieske iron-sulfur protein. P. aerophilum proteins typically exhibit remarkable thermostability, maintaining their structure and function at temperatures around 100°C .

The thermostability of P. aerophilum cobS likely arises from several structural features:

  • Increased number of salt bridges and electrostatic interactions

  • Enhanced hydrophobic core packing

  • Reduced number of thermolabile residues

  • Potentially higher proportion of certain amino acids (Glu, Arg) that contribute to thermostability

  • Structural rigidity in regions not directly involved in catalysis

In practical terms, while mesophilic cobS enzymes would typically denature at temperatures above 60-70°C, P. aerophilum cobS should remain stable and active at temperatures exceeding 90°C. This thermostability makes it particularly valuable for applications requiring heat-resistant enzymes or for studying the structural basis of protein thermostability .

What methodologies can be used to study the kinetics of P. aerophilum cobS and how do they compare to the kinetics of cobS from mesophilic organisms?

For studying P. aerophilum cobS kinetics, researchers should consider the following methodologies:

  • High-temperature enzyme assays: Using specialized equipment capable of maintaining reaction temperatures of 85-100°C while monitoring activity.

  • Spectrophotometric assays: Monitoring the formation of products or consumption of substrates through changes in absorbance at specific wavelengths.

  • HPLC-based assays: Similar to those used for studying CbiR from A. muciniphila, where reaction products are separated and quantified by HPLC with UV-Vis detection .

  • Steady-state kinetics: Determining KM and kcat values at varying substrate concentrations under optimal temperature conditions.

  • Comparative analysis: Testing kinetic parameters at different temperatures to construct an Arrhenius plot and determine activation energy.

Comparative studies would likely reveal that P. aerophilum cobS has:

  • Higher optimal temperature for catalysis (85-100°C vs. 30-40°C for mesophilic enzymes)

  • Potentially lower catalytic efficiency (kcat/KM) at lower temperatures

  • Different pH-dependence profile

  • Greater resistance to denaturation by heat, chemicals, and proteases

While specific kinetic values for cobS are not provided in the search results, related studies on CbiR from A. muciniphila showed a KM of 194 μM and kcat of 6.5 min⁻¹ for AdoCbl hydrolysis . P. aerophilum cobS might exhibit different kinetic parameters reflecting its adaptation to extreme conditions.

How can researchers investigate the potential role of P. aerophilum cobS in cobamide remodeling similar to the CbiR enzyme in A. muciniphila?

To investigate whether P. aerophilum cobS might participate in cobamide remodeling similar to CbiR in A. muciniphila, researchers could employ the following experimental approach:

  • Comparative genomic analysis: Search for genes in P. aerophilum that might code for enzymes involved in cobamide remodeling, including those with sequence similarity to CbiR or CbiZ.

  • In vitro activity assays: Test purified recombinant cobS with various cobamides as substrates, analyzing reaction products by HPLC and mass spectrometry as done for CbiR .

  • Growth studies with different cobamides: Culture P. aerophilum with various cobamides and analyze the corrinoid composition of cell extracts to determine if remodeling occurs in vivo.

  • Heterologous expression studies: Express P. aerophilum cobS in an E. coli strain engineered to depend on specific cobamides, testing whether cobS enables growth with normally unusable cobamides.

  • Phylogenetic analysis: Compare cobS with known cobamide remodeling enzymes to identify potential evolutionary relationships.

These experiments would help determine whether P. aerophilum cobS has dual functionality in both cobamide synthesis and remodeling, or if these processes are carried out by distinct enzymes in this organism.

What techniques are most appropriate for studying the structure-function relationship of P. aerophilum cobS under extreme conditions?

To elucidate the structure-function relationship of P. aerophilum cobS under extreme conditions, researchers should consider the following techniques:

  • X-ray crystallography at elevated temperatures: Obtaining crystal structures at different temperatures to observe conformational changes.

  • Molecular dynamics simulations: Computational modeling of protein behavior at high temperatures to identify key stabilizing interactions.

  • Site-directed mutagenesis: Systematically altering residues predicted to be important for thermostability or catalysis, followed by functional assays.

  • Circular dichroism spectroscopy with temperature ramping: Monitoring secondary structure changes during heating and cooling to assess thermal stability and refolding capacity.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identifying regions of the protein with different flexibility/rigidity at various temperatures.

  • Differential scanning calorimetry (DSC): Determining the melting temperature (Tm) and thermodynamic parameters of thermal unfolding.

  • In situ neutron scattering: Providing insights into protein dynamics at different temperatures under conditions mimicking the native environment.

These approaches would help identify the structural features responsible for the enzyme's thermostability and activity under extreme conditions, potentially revealing design principles that could be applied to engineer thermostability in other proteins.

What are the common challenges in expressing and purifying active recombinant P. aerophilum cobS?

Researchers working with recombinant P. aerophilum cobS commonly encounter the following challenges:

  • Protein misfolding in mesophilic expression hosts: The protein may not fold correctly at lower temperatures typical for E. coli growth.

    • Solution: Use lower induction temperatures (16-20°C) and extended expression times.

  • Inclusion body formation: Overexpression often leads to insoluble protein aggregates.

    • Solution: Express with solubility-enhancing tags like MBP or SUMO; optimize expression conditions; consider refolding protocols if necessary.

  • Low activity of recombinant protein: The enzyme may lack proper cofactors or post-translational modifications.

    • Solution: Supplement growth media with potential cofactors; consider co-expression of chaperones.

  • Protein instability during purification: Despite the protein's thermostability, intermediates during folding may be sensitive to degradation.

    • Solution: Include protease inhibitors; perform purification steps quickly at 4°C before a final heat treatment.

  • Difficulty in activity assays due to high temperature requirements: Standard equipment may not be suitable for assays at 85-100°C.

    • Solution: Develop specialized high-temperature assay systems; consider testing activity at moderately high temperatures (60-70°C) as a compromise.

Similar challenges were addressed when working with the Rieske iron-sulfur protein from P. aerophilum, where researchers successfully expressed soluble, thermostable proteins with correctly inserted iron-sulfur clusters by optimizing expression constructs .

How can the stability and activity of purified recombinant cobS be maintained during storage and experimental use?

Based on information provided for the commercial recombinant product and knowledge of thermostable proteins, the following recommendations can be made for maintaining stability and activity:

Storage Conditions:

  • Store at -20°C for regular use or -80°C for long-term storage

  • Use a storage buffer containing Tris-based buffer with 50% glycerol

  • Divide the purified protein into small working aliquots to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Stabilizing Additives:

  • 50% glycerol for freezing stocks

  • 5-10% glycerol for working solutions

  • 1-5 mM reducing agents (DTT, TCEP, or β-mercaptoethanol) to maintain thiol groups

  • Consider adding metal ions if they are cofactors for the enzyme

Handling Recommendations:

  • Avoid repeated freezing and thawing

  • Pre-warm buffers to room temperature before adding the enzyme to prevent cold-shock

  • Use protein-low binding tubes for storage

  • For experiments, pre-equilibrate the enzyme at the experimental temperature before adding substrates

These measures will help maintain the structural integrity and catalytic activity of the enzyme during storage and experimental procedures.

What control experiments should be included when characterizing the activity of recombinant P. aerophilum cobS?

When characterizing recombinant P. aerophilum cobS activity, the following control experiments should be included:

  • Negative controls:

    • Heat-inactivated enzyme (heating beyond the thermal stability of the enzyme)

    • Reaction mixture without enzyme

    • Reaction mixture without key substrates or cofactors

    • Reaction with a catalytically inactive mutant (e.g., site-directed mutation of predicted catalytic residues)

  • Positive controls:

    • Commercial cobS enzyme if available

    • Reaction with a known substrate under optimized conditions

    • Inclusion of a well-characterized related enzyme with similar activity

  • Specificity controls:

    • Testing activity with substrate analogs

    • Assessing activity in the presence of known inhibitors of related enzymes

    • Performing the reaction with cobS enzymes from mesophilic organisms for comparison

  • Technical validation:

    • Multiple biological replicates (different protein preparations)

    • Multiple technical replicates for each condition

    • Enzyme concentration-dependence tests to ensure linearity of the assay

    • Time-course experiments to ensure measurements are made in the linear range of the reaction

These controls will help validate the specificity and reliability of the activity assays and ensure that the observed activity is genuinely attributable to the recombinant P. aerophilum cobS.

How can P. aerophilum cobS be utilized in synthetic biology applications?

P. aerophilum cobS offers several promising applications in synthetic biology:

  • Thermostable enzymatic pathways: Integration into synthetic pathways for vitamin B12 production that can operate at elevated temperatures, potentially increasing reaction rates and reducing contamination risks.

  • Cell-free biosynthetic systems: Development of heat-resistant cell-free systems for the production of cobamides and related compounds, utilizing the thermostability of cobS to enable reactions at temperatures that would inactivate conventional enzymes.

  • Enzyme scaffolding: Creating thermostable enzyme complexes by fusing cobS with other thermostable enzymes involved in related metabolic pathways to enhance pathway efficiency through substrate channeling.

  • Biosensors: Development of thermostable biosensors for cobalamin or related molecules that can function in harsh environments.

  • Biocatalysis: Utilizing cobS in industrial biocatalytic processes that require operation at elevated temperatures for improved solubility of substrates, increased reaction rates, or reduced risk of contamination.

The unique properties of this enzyme could enable biotechnological applications in environments where mesophilic enzymes would rapidly denature, opening new possibilities for biocatalysis under extreme conditions.

What are the most promising research directions for understanding the evolution of cobalamin biosynthesis in extremophiles like P. aerophilum?

Several promising research directions for understanding cobalamin biosynthesis evolution in extremophiles include:

  • Comparative genomic analysis: Systematic comparison of cobalamin biosynthesis pathways across archaeal extremophiles to identify conserved elements and unique adaptations.

  • Ancestral sequence reconstruction: Computational reconstruction and experimental characterization of ancestral cobS enzymes to understand the evolutionary trajectory of thermoadaptation.

  • Horizontal gene transfer investigation: Analysis of potential horizontal gene transfer events that might have shaped cobalamin biosynthesis in archaea.

  • Structure-function studies across temperature gradients: Comparative analysis of cobS enzymes from organisms with different temperature optima to understand the structural basis of thermoadaptation.

  • Metabolic network analysis: Investigation of how cobalamin-dependent metabolic pathways have co-evolved with cobalamin biosynthesis in extremophiles.

  • Environmental sampling and metagenomics: Analysis of cobS diversity in extreme environments to discover novel variants with unique properties.

Such research would provide insights into how essential metabolic pathways adapt to extreme conditions and could reveal fundamental principles of protein evolution and adaptation.

How might understanding P. aerophilum cobS contribute to our knowledge of microbial adaptation to extreme environments?

Studying P. aerophilum cobS can provide valuable insights into microbial adaptation to extreme environments in several ways:

  • Molecular basis of thermostability: Identifying the specific structural features that enable cobS to function at temperatures around 100°C can reveal general principles of protein thermostability applicable to other enzymes.

  • Evolution of essential pathways under extreme conditions: Understanding how a critical metabolic pathway like cobalamin biosynthesis adapts to extreme conditions provides insights into the constraints and flexibilities of core metabolism.

  • Enzyme kinetics at high temperatures: Elucidating how reaction rates, substrate affinities, and catalytic mechanisms change at extreme temperatures can inform our understanding of the limits of enzymatic catalysis.

  • Metabolic efficiency in extremophiles: Investigating whether P. aerophilum possesses unique adaptations in its B12-dependent pathways that enhance metabolic efficiency under extreme conditions.

  • Environmental niche adaptation: Understanding how the characteristics of cobS might contribute to P. aerophilum's ability to occupy specific ecological niches unavailable to organisms with less thermostable enzymes.

These insights would not only advance our fundamental understanding of life in extreme environments but could also inform biotechnological applications and our search for life in extreme environments on Earth and potentially beyond.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.