Recombinant Pyrobaculum aerophilum Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
uppP; bacA; upk; PAE0576; Undecaprenyl-diphosphatase; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827)
Target Names
uppP
Target Protein Sequence
MDLGVAAILGVVQGISEWLPISSKTQIMLVSIWLLNASPEYAYSLGLFLEAASVLAALIY FRGVYLKALRGFVGDAEGRRWLVYILVTTLVTAVVGLPLYYVARKWLVVGHSAGFLMIVL GLAVVLNAVFLQRARFSAGLKAFDNMSLRDMAIVGIAQAVSVLPGLSRSGATVTALLLLG YKPEEAFRASFVLVPVAGLGATALAYLSEGGAVATAEALLAMAIGIVISIITIKALLEFA KSKHVVLVNVVIGLLAIAGGLLRIIF
Uniprot No.

Target Background

Function

Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP).

Database Links

KEGG: pai:PAE0576

STRING: 178306.PAE0576

Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its function in Pyrobaculum aerophilum?

Undecaprenyl-diphosphatase (uppP), also known as Undecaprenyl pyrophosphate phosphatase (EC 3.6.1.27), is an enzyme involved in peptidoglycan biosynthesis. In P. aerophilum, this enzyme catalyzes the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate, which serves as a lipid carrier for cell wall precursors. This reaction is crucial for recycling the lipid carrier during cell wall synthesis . The enzyme is encoded by the uppP gene (also known as bacA in some organisms) and represents a critical component in maintaining cell envelope integrity .

What are the structural characteristics of P. aerophilum uppP?

P. aerophilum uppP is a hydrophobic integral membrane protein predicted to contain eight transmembrane helices, similar to other archaeal and bacterial homologs . The full-length protein consists of 266 amino acids with the sequence beginning with MDLGVAAILGVVQGISEWLPISSKQ . Its structure reflects adaptations for function within the extreme temperature environments where P. aerophilum thrives (optimal growth at 100°C) . The protein's hydrophobic nature is consistent with its role in membrane-associated phospholipid metabolism and its involvement in cell wall biosynthesis pathways.

How does P. aerophilum's extreme growth environment affect uppP function?

P. aerophilum is a hyperthermophile with optimal growth at 100°C and maximum temperature tolerance of 104°C . Its uppP enzyme must function efficiently at these extreme temperatures, suggesting structural adaptations that maintain activity and prevent denaturation. These adaptations likely include increased hydrophobic interactions, additional salt bridges, and a compact folding structure that resists thermal denaturation. The enzyme's function in maintaining cell envelope integrity is particularly critical under these extreme conditions where membrane fluidity and stability are constantly challenged.

How does P. aerophilum uppP activity correlate with the organism's unique sulfur metabolism?

P. aerophilum exhibits an unusual intolerance to elemental sulfur, distinguishing it from closely related species including other Pyrobaculum members . This sulfur sensitivity appears linked to disruptions in the adenylylsulfate reductase genes, with both subunits containing inactivating mutations .

The uppP enzyme functions in cell envelope maintenance, while sulfur metabolism affects energy generation and redox balance. The correlation between these systems likely involves cellular stress responses and membrane integrity. When P. aerophilum encounters elemental sulfur, the compromised sulfur metabolism pathway may generate toxic intermediates that stress the cell envelope. Under these conditions, uppP activity may be upregulated as part of a broader stress response aimed at maintaining cell wall integrity. Research exploring this interplay could reveal important adaptations of extremophiles to environmental stressors.

What are the evolutionary implications of P. aerophilum uppP compared to mesophilic homologs?

The evolutionary trajectory of uppP in P. aerophilum represents a fascinating case of adaptation to extreme environments. Comparative analysis with mesophilic homologs like those from E. coli or E. faecalis reveals how selective pressures have shaped this enzyme for hyperthermophilic conditions.

Despite functional conservation, P. aerophilum uppP likely exhibits thermostabilizing adaptations including increased hydrophobic core packing, additional salt bridges, and reduction of thermolabile residues. These adaptations maintain catalytic function while preventing thermal denaturation at temperatures that would destroy mesophilic proteins. Evolutionary rate analysis might reveal whether uppP has undergone accelerated evolution during adaptation to extreme environments or if purifying selection has maintained a highly conserved structure due to its essential cellular function.

What are the optimal conditions for expressing recombinant P. aerophilum uppP?

Expressing recombinant P. aerophilum uppP presents unique challenges due to its membrane-associated nature and origin from a hyperthermophile. Based on successful production protocols:

Expression System:

  • Use E. coli strains optimized for membrane protein expression (C41, C43, or LEMO21)

  • Consider codon optimization for E. coli expression, especially for rare codons

Expression Conditions:

  • Induce at lower temperatures (15-20°C) for 16-24 hours to allow proper folding

  • Use IPTG concentrations of 0.1-0.5 mM for induction

  • Include glycerol (5-10%) in the media to stabilize membrane proteins

Purification Strategy:

  • Extract with mild detergents (DDM, LDAO) rather than harsh denaturants

  • Utilize a two-step purification process (IMAC followed by size exclusion chromatography)

  • Store in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage

Remember that as a hyperthermophilic protein, P. aerophilum uppP may exhibit unusual folding characteristics at mesophilic temperatures, potentially affecting activity measurements if not properly handled.

What assays are most effective for measuring P. aerophilum uppP enzymatic activity?

Measuring P. aerophilum uppP activity requires specialized assays that account for its hyperthermophilic nature:

Phosphate Release Assay:

  • Substrate: Synthetic undecaprenyl pyrophosphate

  • Buffer: 50 mM HEPES, pH 7.5 (pH measured at reaction temperature)

  • Temperature range: 50-90°C (compromise between enzyme optimum and practical limitations)

  • Detection: Released phosphate measured by malachite green assay

Radiolabeled Substrate Assay:

  • Substrate: [³²P]-labeled undecaprenyl pyrophosphate

  • Separation: Thin-layer chromatography on silica with chloroform:methanol:water (65:25:4)

  • Detection: Autoradiography or phosphorimaging

Temperature Effects Protocol:

  • Pre-equilibrate reaction components to desired temperature

  • Initiate reaction by enzyme addition

  • Incubate at temperature range (50-100°C) for predetermined time points

  • Terminate reaction by rapid cooling and addition of stop solution

  • Analyze products as appropriate for selected assay

For meaningful data, include enzyme-free controls to account for non-enzymatic hydrolysis, which increases at extreme temperatures.

How can researchers effectively purify active P. aerophilum uppP for structural studies?

Purifying active P. aerophilum uppP for structural studies requires careful consideration of its membrane-associated nature and thermophilic properties:

Purification Protocol:

  • Membrane Fraction Isolation:

    • Lyse cells by French press or sonication in buffer containing protease inhibitors

    • Collect membrane fraction by ultracentrifugation (100,000 × g, 1 hour)

    • Solubilize using detergent screen (test DDM, LDAO, LMNG at 1-2% w/v)

  • Affinity Chromatography:

    • Utilize His-tag or other affinity tag incorporated during cloning

    • Use thermostable affinity resins if possible

    • Include 0.02-0.05% detergent in all buffers to maintain solubility

  • Size Exclusion Chromatography:

    • Remove aggregates and purify monodisperse protein

    • Buffer exchange to final storage buffer with reduced detergent concentration

  • Thermostability Verification:

    • Confirm protein remains folded after heating to 80-90°C using circular dichroism

    • Verify activity retention after heat treatment

For structural studies, consider:

  • Crystallization: Lipidic cubic phase methods often successful for membrane proteins

  • Cryo-EM: Reconstitution in nanodiscs or amphipols to preserve native-like environment

  • NMR: Isotopic labeling (¹⁵N, ¹³C) during expression for solution NMR studies

The purified protein should be stored in a Tris-based buffer with 50% glycerol at -20°C or -80°C to maintain stability for extended periods .

How does P. aerophilum uppP compare functionally to its bacterial homologs?

P. aerophilum uppP shares fundamental catalytic functions with bacterial homologs but exhibits distinct characteristics reflecting its archaeal origin and hyperthermophilic lifestyle:

CharacteristicP. aerophilum uppPBacterial Homologs (E. coli/E. faecalis)
Temperature optimum~90-100°C30-37°C
pH optimumLikely alkaline (7.5-8.5)Near neutral (6.5-7.5)
Membrane topology8 predicted transmembrane helices8-10 transmembrane helices
Bacitracin resistanceUnknown, likely confers resistanceConfers significant resistance
Thermal stabilityExtremely highModerate
Sequence identityReference30-45%
Substrate specificityUndecaprenyl pyrophosphateUndecaprenyl pyrophosphate, possibly broader

The P. aerophilum enzyme likely maintains its catalytic mechanism under extreme conditions where mesophilic homologs would denature completely. While bacterial uppP enzymes have been shown to confer bacitracin resistance , the role of P. aerophilum uppP in antibiotic resistance remains to be fully characterized, particularly given the environmental isolation of this organism from antibiotic selection pressures.

What structural adaptations distinguish P. aerophilum uppP from mesophilic homologs?

While high-resolution structural data specifically for P. aerophilum uppP is limited, comparative analysis with mesophilic homologs reveals several likely thermostabilizing adaptations:

These adaptations collectively contribute to P. aerophilum uppP's ability to maintain its native fold and catalytic activity at temperatures exceeding 100°C, while retaining the core functionality shared with mesophilic homologs.

How does the genomic context of uppP in P. aerophilum compare with other archaea and bacteria?

The genomic neighborhood of genes often provides insights into functional relationships and evolutionary history. For P. aerophilum uppP:

P. aerophilum uppP Genomic Context:

  • Gene designation: PAE0576

  • Located in proximity to cell envelope biogenesis genes

Comparative Genomic Organization:

OrganismGene NeighborsOperon StructureRegulatory Elements
P. aerophilumCell wall biosynthesis genesLikely monocistronicUnknown promoter elements
E. coliPeptidoglycan synthesis genesMonocistronicσ70-dependent promoter
E. faecalisCell wall metabolism genesOften in operons with cell envelope genesConstitutive expression
Other archaeaVarious, depending on speciesVariableOften constitutive

In E. faecalis, uppP expression is constitutive and not affected by bacitracin or cell wall-active antimicrobials . This suggests that despite its role in resistance, uppP is not part of an inducible stress response. The P. aerophilum genomic context differs significantly from bacteria, reflecting the distinct cell envelope architecture of archaea and potentially different regulatory mechanisms.

Unlike in some bacteria where uppP (bacA) genes are part of larger operons, the genomic context in P. aerophilum suggests different evolutionary pressures, possibly related to its extreme environmental niche and unique cell envelope requirements.

What research gaps remain in understanding P. aerophilum uppP function and applications?

Several critical knowledge gaps persist regarding P. aerophilum uppP that warrant further investigation:

  • Structural characterization: No high-resolution structure exists for P. aerophilum uppP, limiting understanding of its thermostability mechanisms and catalytic properties.

  • Kinetic parameters: Comprehensive enzyme kinetics at various temperatures (60-100°C) would elucidate temperature-activity relationships of this thermophilic enzyme.

  • Physiological role: While uppP homologs confer bacitracin resistance in bacteria , the physiological importance in P. aerophilum remains unclear, particularly given its unique environmental niche.

  • Substrate specificity: Whether P. aerophilum uppP has broader substrate specificity than bacterial homologs remains undetermined.

  • Interaction partners: Potential protein-protein interactions within the cell envelope biosynthesis machinery have not been characterized.

Addressing these gaps would significantly advance understanding of extremozyme adaptations and potentially reveal novel biotechnological applications for this unique phosphatase.

How might researchers engineer P. aerophilum uppP for biotechnological applications?

The exceptional thermostability of P. aerophilum uppP presents numerous biotechnological opportunities through protein engineering approaches:

Potential Engineering Strategies:

  • Improved Expression:

    • Codon optimization for industrial expression hosts

    • Signal sequence modifications for enhanced membrane integration

    • Fusion tags for simplified purification while maintaining activity

  • Substrate Range Expansion:

    • Targeted mutations in the substrate binding pocket

    • Directed evolution under selective pressure with alternative substrates

    • Computational design of modified active sites

  • Stability Enhancement:

    • Further stabilization for industrial conditions (solvent tolerance)

    • Immobilization strategies for continuous processing

    • Rational design based on structural information

Potential Applications:

  • Biocatalysis: High-temperature phosphatase reactions in industrial processes

  • Biosensors: Thermostable components for high-temperature sensing applications

  • Antibiotic Research: Model system for understanding phosphatase-mediated resistance mechanisms

  • Biomaterial Production: Engineered variants for specific modifications of lipid carriers

Each application would require targeted engineering strategies based on fundamental understanding of P. aerophilum uppP's structure-function relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.