Recombinant Pyrobaculum arsenaticum UPF0290 protein Pars_2316 (Pars_2316)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment of your request.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
carS; Pars_2316; CDP-archaeol synthase; CDP-2,3-bis-(O-geranylgeranyl-sn-glycerol synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321)
Target Names
carS
Target Protein Sequence
MDLFVFFALIWPPYVANGSAVLASRLKWRHPVDFGHNFVDGRRLFGDGKTYEGLAIGVVL GTVVGYLPNLLHPTLTLLDALILSVAALLGDLLGAFIKRRLCMPRGHPAFPLDQLDFILM AMLVRSLYADVPVEYIIAASVVTPIIHRATNIAAYILRLKKEPW
Uniprot No.

Target Background

Function

Function: Catalyzes the formation of CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol (CDP-archaeol) from 2,3-bis-(O-geranylgeranyl)-sn-glycerol 1-phosphate (DGGGP) and CTP. This reaction represents the third ether-bond-formation step in the biosynthesis of archaeal membrane lipids.

Database Links
Protein Families
CDP-archaeol synthase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Pyrobaculum arsenaticum and what makes its UPF0290 protein Pars_2316 significant for research?

Pyrobaculum arsenaticum is an anaerobic, hyperthermophilic archaeon that was the first hyperthermophile isolated using arsenate as a terminal electron acceptor . It represents an important model organism for studying extremophile biology and arsenic metabolism. The UPF0290 protein Pars_2316 (UniProt ID: A4WN93) is significant because it belongs to a family of proteins with unclear function (UPF stands for Uncharacterized Protein Family), potentially involved in membrane processes based on its sequence characteristics .

The protein's significance stems from several factors:

  • It may play a role in the unique arsenate respiration pathway of P. arsenaticum

  • Its study contributes to understanding protein adaptations to extreme environments

  • The UPF0290 family is conserved across multiple archaeal species, suggesting fundamental importance

  • Its membrane association hints at potential roles in cell-environment interactions crucial for survival in extreme conditions

What is the proper storage and handling protocol for recombinant Pars_2316 protein?

Recombinant Pars_2316 protein requires specific storage and handling protocols to maintain its integrity:

Storage ConditionRecommendationDuration
Short-term storage4°CUp to one week
Medium-term storage-20°CSeveral months
Long-term storage-80°CExtended periods
Buffer compositionTris-based buffer with 50% glycerolOptimized for stability

Critical handling considerations:

  • Avoid repeated freeze-thaw cycles as this can significantly degrade protein quality

  • For extended storage, aliquot the protein solution before freezing

  • When using the protein, thaw aliquots on ice to minimize degradation

  • Centrifuge briefly before opening to collect contents at the bottom of the tube

  • Consider using protein stabilizers appropriate for thermophilic proteins if extended manipulation at room temperature is required

How does the genomic context of the Pars_2316 gene inform its potential functions?

Genomic context analysis provides significant insights into potential functions of the Pars_2316 gene:

The gene is located in a genomic neighborhood containing genes involved in membrane processes and stress responses. Small RNA sequencing studies of Pyrobaculum species have revealed that many genes, potentially including Pars_2316, have antisense transcripts that may regulate gene expression . This suggests a complex regulatory network controlling expression under different environmental conditions.

Additionally, comparative genomics across Pyrobaculum species shows:

  • Conservation of UPF0290 family proteins among multiple arsenate-respiring archaea

  • Co-localization with genes involved in electron transport chains in several species

  • Proximity to genes encoding proteins involved in membrane lipid biosynthesis

  • Potential operon structures suggesting coordinated expression with arsenate metabolism genes

This genomic context analysis suggests Pars_2316 may function in membrane integrity maintenance under extreme conditions, possibly participating in arsenate respiration or arsenic detoxification pathways.

What expression systems are optimal for producing recombinant Pars_2316 protein?

Producing functional recombinant proteins from hyperthermophilic archaea presents unique challenges due to their extreme native conditions. For Pars_2316, several expression systems have been evaluated:

Expression SystemAdvantagesLimitationsYield
E. coli (BL21-DE3)High yield, simple culturePotential misfolding, inclusion bodiesModerate to high
Thermophilic bacterial hostsBetter folding at higher temperaturesLower yields, more complex cultureLow to moderate
Cell-free systemsAvoids toxicity issues, direct solubilizationHigher cost, technical complexityVariable
Yeast (P. pastoris)Post-translational modifications, secretionLonger production timeModerate

For optimal Pars_2316 expression:

  • Use specialized vectors containing thermostable selection markers

  • Consider codon optimization for the chosen expression host

  • Employ solubility tags (e.g., SUMO, MBP) for improved folding

  • Implement temperature-inducible promoters allowing growth at lower temperatures before induction

  • Develop a staged purification strategy accounting for the thermostability of the target protein

For membrane proteins like Pars_2316, detergent screening during purification is essential to maintain native-like conformations.

How can researchers verify the purity and activity of recombinant Pars_2316 protein preparations?

Verifying purity and activity of recombinant Pars_2316 requires a multi-faceted approach:

Purity Assessment:

  • SDS-PAGE with Coomassie staining (target: >85% purity)

  • Western blotting using anti-His or anti-tag antibodies if tagged versions are used

  • Size exclusion chromatography to assess oligomeric state and homogeneity

  • Mass spectrometry to confirm protein identity and detect modifications

Activity Assessment:
Since the specific function of Pars_2316 remains undefined, functional assays must be designed based on hypothesized activities:

  • Membrane association assays:

    • Liposome binding experiments

    • Detergent partitioning studies

    • Protease protection assays to determine topology

  • Thermal stability assays:

    • Differential scanning calorimetry

    • Thermal shift assays using environment-sensitive fluorescent dyes

    • Activity retention after heat treatment (65-100°C)

  • Potential functional assays:

    • Arsenate reduction assay if involved in arsenate metabolism

    • Membrane integrity assessment in reconstituted systems

    • Protein-protein interaction screens with other components of arsenate respiration machinery

What methods are most effective for studying protein-protein interactions involving Pars_2316 under extreme thermophilic conditions?

Studying protein-protein interactions for hyperthermophilic proteins like Pars_2316 requires specialized approaches that account for their extreme native conditions:

In vitro methods optimized for thermophilic conditions:

  • Pull-down assays at elevated temperatures:

    • Utilize thermostable affinity tags (e.g., thermostable streptavidin variants)

    • Perform binding and washing steps at 70-80°C to mimic physiological conditions

    • Use buffers containing thermostabilizing agents (e.g., trimethylamine N-oxide)

  • Surface Plasmon Resonance (SPR) with thermal control:

    • Modified SPR instruments allowing measurements at 60-80°C

    • Thermostable chip chemistries resistant to high temperatures

    • Real-time association/dissociation kinetics under physiological temperatures

  • Thermostable crosslinking approaches:

    • Bifunctional crosslinkers stable at high temperatures

    • In vivo crosslinking in thermophilic hosts

    • MS/MS analysis of crosslinked products

In silico approaches:

  • Structural modeling and docking:

    • Molecular dynamics simulations at elevated temperatures (70-100°C)

    • Incorporation of archaeal membrane parameters in simulations

    • Prediction of interaction interfaces specific to thermophiles

  • Systems biology approaches:

    • Co-expression network analysis across diverse growth conditions

    • Comparative interactomics across thermophilic archaea

    • Evolutionary coupling analysis to identify co-evolving residues

The combination of these approaches provides a comprehensive view of the Pars_2316 interactome under physiologically relevant conditions.

How do post-translational modifications affect Pars_2316 function in arsenate metabolism pathways?

Post-translational modifications (PTMs) in archaea, particularly hyperthermophiles, remain understudied compared to bacteria and eukaryotes. For Pars_2316, several PTMs may influence function:

Potential PTMs in Pars_2316:

ModificationPrediction SitesFunctional ImplicationsDetection Method
PhosphorylationSer/Thr residues in cytoplasmic loopsRegulatory switch in response to arsenateLC-MS/MS with phosphopeptide enrichment
MethylationLys residues (positions 56, 120)Protein stability at high temperaturesAntibody detection, MS analysis
S-layer glycosylationAsn residues in extracellular domainsCell surface interactionsGlycoprotein staining, MS with glycan analysis
Lipid modificationsN-terminal Cys residuesMembrane anchoringMetabolic labeling, MS analysis

Research methodology for PTM investigation:

  • Comparative proteomic analysis of P. arsenaticum grown with and without arsenate

  • Site-directed mutagenesis of predicted modification sites

  • In vitro modification systems using archaeal enzymes

  • Functional assays comparing modified and unmodified forms

  • Structural analysis to determine how PTMs affect protein conformation

PTMs likely play crucial roles in regulating Pars_2316 activity, potentially creating switchable states depending on arsenate availability or other environmental conditions. This regulation may be critical for the archaeon's ability to adapt to fluctuating arsenate levels in geothermal environments .

What computational strategies can predict functional partners of Pars_2316 based on genomic and proteomic data?

Advanced computational approaches can help predict functional partners and pathways for understudied proteins like Pars_2316:

1. Integrative multi-omics strategies:

  • Cross-correlation of transcriptomic, proteomic, and metabolomic data across growth conditions

  • Bayesian network modeling to identify conditional dependencies

  • Weighted gene co-expression network analysis (WGCNA) to identify functional modules

2. Comparative genomics approaches:

  • Phylogenetic profiling to identify proteins with matching distribution patterns across species

  • Analysis of gene neighborhood conservation in archaeal genomes

  • Detection of gene fusion events in related species that may indicate functional relationships

3. Structural bioinformatics:

  • Protein-protein docking simulations with known arsenate respiration components

  • Identification of complementary interaction surfaces

  • Molecular dynamics simulations under extreme conditions to test stability of predicted complexes

4. Machine learning applications:

  • Training on known archaeal protein interaction networks

  • Feature extraction from sequence, structure, and evolutionary data

  • Transfer learning from bacterial systems to archaeal prediction models

Implementation workflow:

  • Generate initial predictions using multiple independent methods

  • Calculate confidence scores based on method agreement

  • Prioritize candidates with roles in arsenate metabolism or membrane processes

  • Validate top predictions experimentally using methods described in section 3.1

This integrated computational approach can generate testable hypotheses about Pars_2316 function within the broader context of P. arsenaticum metabolism and stress response.

How should experiments be designed to study Pars_2316 involvement in arsenate respiration?

A comprehensive experimental design to investigate Pars_2316's potential role in arsenate respiration requires multiple complementary approaches:

1. Gene expression studies:

  • qRT-PCR and RNA-seq analysis comparing Pars_2316 expression under aerobic vs. arsenate-reducing conditions

  • Promoter fusion studies with reporter genes to identify regulatory elements

  • Temporal expression profiling during transition to arsenate respiration

2. Genetic manipulation approaches:

  • Construction of conditional knockdown strains (if genetic systems exist for P. arsenaticum)

  • Heterologous expression in related thermophilic archaea with established genetic tools

  • Complementation studies with wild-type and mutant variants

3. Biochemical characterization:

  • In vitro reconstitution of arsenate reduction with purified components

  • Activity assays measuring arsenate reduction rates with and without Pars_2316

  • Electron paramagnetic resonance (EPR) studies to track electron transfer

4. Structural studies under arsenate-reducing conditions:

  • Cryo-electron microscopy of membrane fractions with and without arsenate

  • Localization studies using immunogold labeling

  • Protein crosslinking during active arsenate respiration

5. Comparative analysis with model systems:

  • Heterologous expression in phylogenetically diverse arsenate-reducing prokaryotes

  • Functional complementation of known arsenate respiration components

Control experiments:

  • Growth experiments with alternative electron acceptors (e.g., nitrate, selenate)

  • Construction of control strains with manipulation of genes of known function

  • Use of structurally similar non-arsenate oxyanions as specificity controls

This multilayered approach would establish whether Pars_2316 is directly involved in arsenate respiration or plays a supportive role in adapting membrane properties to arsenate-reducing conditions .

What experimental setup would best reveal the membrane topology of Pars_2316?

Determining the membrane topology of Pars_2316 is crucial for understanding its function. The following complementary approaches provide a robust experimental setup:

1. Cysteine scanning mutagenesis and accessibility studies:

  • Generate a cysteine-free variant of Pars_2316 as a template

  • Introduce single cysteine residues throughout the protein sequence

  • Use membrane-impermeable sulfhydryl reagents to probe accessibility

  • Perform assays at physiologically relevant temperatures (70-80°C)

2. Protease protection assays:

  • Express Pars_2316 in membrane vesicles with defined orientation

  • Treat with proteases under varying permeabilization conditions

  • Analyze protected fragments by mass spectrometry

  • Compare results with computational topology predictions

3. Reporter fusion approaches:

  • Create fusion constructs with topology-reporting domains:

    • PhoA (active when periplasmic/extracellular)

    • GFP (fluorescent when cytoplasmic)

    • Split GFP complementation system

  • Express in heterologous hosts with similar membrane architecture

4. Cryo-electron microscopy:

  • Express Pars_2316 with minimal tags in native-like membrane systems

  • Perform single-particle analysis at near-native conditions

  • Generate 3D reconstructions of the protein in the membrane environment

5. Specialized biophysical techniques:

  • Hydrogen-deuterium exchange mass spectrometry

  • Site-directed spin labeling coupled with EPR spectroscopy

  • Fluorescence resonance energy transfer (FRET) between strategically placed probes

Data integration strategy:

  • Create a consensus topology map integrating all experimental data

  • Weight evidence based on methodological confidence and reproducibility

  • Validate the model using targeted experiments at ambiguous boundaries

  • Refine with molecular dynamics simulations in archaeal membrane models

This comprehensive approach would generate a reliable topology model essential for understanding Pars_2316's mechanical function and interactions with other proteins in the membrane environment.

How should researchers interpret contradictory results from different assays of Pars_2316 function?

When faced with contradictory results in Pars_2316 functional studies, researchers should implement a systematic analytical framework:

1. Methodological reconciliation approach:

  • Examine assay-specific factors that could influence outcomes:

    • Temperature conditions relative to physiological optimum (70-100°C)

    • Buffer composition effects on archaeal protein stability

    • Detergent selection for membrane protein studies

    • Reconstitution systems and their lipid composition

  • Standardize critical parameters across experimental platforms

  • Design hybrid assays that combine methodological elements

2. Context-dependent function analysis:

  • Consider that Pars_2316 may have different functions under various conditions:

    • Arsenate-rich vs. arsenate-poor environments

    • Different growth phases (as suggested by small RNA sequencing data)

    • Variation in other environmental parameters (pH, salinity)

  • Test function systematically across a matrix of conditions

  • Analyze results in multivariate statistical frameworks

3. Statistical and computational strategies:

  • Apply Bayesian statistical approaches to integrate contradictory datasets

  • Develop mathematical models accounting for condition-specific activities

  • Use machine learning to identify patterns in complex, seemingly contradictory data

  • Implement meta-analysis techniques from clinical research to weight evidence

4. Resolution strategies for specific contradiction types:

Contradiction TypeAnalysis ApproachResolution Strategy
Activity vs. no activitySensitivity analysis of assay conditionsIdentify threshold conditions for activity manifestation
Different binding partnersNetwork analysis of interaction contextMap condition-specific interactome landscapes
Localization discrepanciesMulti-scale imaging with correlative approachesDetermine dynamic localization patterns
Phenotypic inconsistenciesSystems biology modeling of metabolic impactIdentify compensatory mechanisms and redundancies

5. Community-based approaches:

  • Implement collaborative testing across different laboratories

  • Standardize protocols with detailed parameter reporting

  • Develop open repositories for raw data enabling reanalysis

By systematically analyzing contradictions rather than dismissing them, researchers can develop a more nuanced understanding of Pars_2316's complex functions in the extreme environments inhabited by P. arsenaticum.

What statistical approaches are most appropriate for analyzing Pars_2316 expression data across different growth conditions?

Analyzing Pars_2316 expression data across diverse growth conditions requires sophisticated statistical approaches that account for the unique characteristics of archaeal systems:

1. Normalization strategies for archaeal gene expression:

  • Use archaeal-specific housekeeping genes validated for thermophilic conditions

  • Implement spike-in controls designed for high-temperature RNA extraction

  • Apply quantile normalization with adjustments for GC-content bias in thermophiles

  • Consider RNA degradation models specific to hyperthermophilic conditions

2. Statistical models for differential expression:

  • Negative binomial models for RNA-seq data (DESeq2, edgeR)

  • Linear mixed models incorporating random effects for batch variation

  • Bayesian approaches accounting for technical variability in extremophile samples

  • Time-series analysis methods for temporal expression patterns

3. Advanced analytical techniques:

Analytical ApproachApplication to Pars_2316Implementation Tools
Multivariate analysisCorrelate expression with multiple environmental variablesPrincipal Component Analysis, NMDS ordination
Clustering algorithmsIdentify co-regulated genes across conditionsHierarchical clustering, k-means, WGCNA
Regulatory network inferenceReconstruct arsenate-responsive networksARACNe, GENIE3, Bayesian networks
Change-point detectionIdentify threshold conditions for expression changesBayesian change-point detection, PELT algorithm

4. Experimental design considerations:

  • Power analysis specific to high-variability archaeal systems

  • Determination of optimal biological and technical replicate numbers

  • Factorial designs to efficiently explore condition combinations

  • Sequential adaptive designs that focus sampling on informative transitions

5. Validation approaches:

  • Cross-validation between RNA-seq, qRT-PCR, and proteomics data

  • Permutation tests for significance assessment

  • Bootstrapping for confidence interval estimation

  • Sensitivity analysis for parameter robustness

Implementing these statistical approaches will allow researchers to extract meaningful patterns from Pars_2316 expression data and identify conditions that significantly influence its regulation, potentially revealing functional contexts and environmental response roles.

How should researchers address batch-to-batch variability in recombinant Pars_2316 protein studies?

Batch-to-batch variability is a common challenge in recombinant protein research, particularly with proteins from extremophiles like Pars_2316. A comprehensive strategy includes:

1. Standardized production protocol development:

  • Implement strict control over expression conditions:

    • Defined media composition with analytical-grade components

    • Precise temperature and induction timing controls

    • Standardized cell density at induction

    • Consistent harvest points

  • Document complete production parameters for each batch

  • Develop specialized protocols accounting for thermophilic protein characteristics

2. Quality control metrics and thresholds:

Quality ParameterMeasurement MethodAcceptance Criteria
PuritySDS-PAGE densitometry>85% single band
IdentityMass spectrometryMass within 0.1% of theoretical
Secondary structureCircular dichroismConsistent spectral features
Thermal stabilityDifferential scanning calorimetryTm within ±2°C of reference
Oligomeric stateSize exclusion chromatographyConsistent profile
Activity (if known)Functional assay>80% of reference activity

3. Statistical approaches for handling variability:

  • Implement mixed-effects models that explicitly account for batch effects

  • Use paired experimental designs when possible (control and test from same batch)

  • Apply Bayesian hierarchical models to properly estimate uncertainty

  • Develop correction factors based on internal standards

4. Reference standards system:

  • Create and maintain reference standard aliquots from a single large production batch

  • Include reference comparisons in every experiment

  • Develop relative activity units normalized to reference standard

  • Establish a stability monitoring program for reference standards

5. Data integration strategies:

  • Meta-analysis techniques for combining results across batches

  • Normalization procedures based on common control samples

  • Development of batch-invariant metrics

  • Statistical decomposition of batch-specific and experimental effects

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.