Recombinant Pyrobaculum calidifontis Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Definition and Origin

The htpX gene (locus Pcal_1192) encodes a homolog of heat shock proteins (HtpX), which are typically involved in protein quality control under stress conditions. Recombinant production in E. coli allows for scalable synthesis of this thermostable protein, which retains its native structure and potential enzymatic activity .

Hypothesized Role:

FunctionEvidence/Inference
Protein Quality ControlHomology to HtpX chaperone-proteases
Stress ResponseExpression under heat shock (inferred)

Expression System

The protein is expressed in E. coli with a His tag for nickel-affinity purification. Yields are moderate (0.1–0.5 mg/L culture), requiring optimization for large-scale production .

Purification Workflow:

  1. Nickel-Affinity Chromatography: Binds via His tag.

  2. Size-Exclusion Chromatography: Removes aggregates.

  3. Lyophilization: Preserved in trehalose/glycerol buffer .

Diagnostic and Assay Development

The recombinant htpX serves as an antigen for antibody production and ELISA/Western blot validation . Commercial ELISA kits (e.g., CSB-CF384318Pzv) utilize this protein, though availability is limited .

Example Use Cases:

ApplicationDescription
Antibody ValidationConfirming cross-reactivity in thermophiles
Protease AssaysSubstrate screening (unpublished)

Research Gaps and Future Directions

  • Functional Characterization: No published enzymatic assays or substrate specificity data.

  • Structural Studies: Crystallization trials are warranted to elucidate active-site geometry.

  • Therapeutic Potential: Unexplored, but thermostable proteases may have industrial applications .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; Pcal_1192; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Pyrobaculum calidifontis (strain JCM 11548 / VA1)
Target Names
htpX
Target Protein Sequence
MIPVFDPVALGLYMLGYLFMFVIAATVAPRVAGAVSGRLTLYGAMALTGVMIVLTTAFVI YLFVLVAAPTLATVSFLVGLIAFVVLMNLLTYVASPYIINASYGARPDPRLQQIVDEVAA RLGAPFKLKAVVVDGPPNAFAYGNFLTGRYVAVTSGMLSLVDRRELEAVIGHEIGHHLHR DNAIMLLFGVLPSVVYYLGVTAVHMGLGSGNSRGGNAALLAVGVVAVLASFLIQLLVLAF SRLREYYADTAGAKAAGKEAMQFALAKIHKFYFMAPEARQAVSESKFRALFIYALVNAVA NPFVTITRAEVEQIKRANYSALQEVFSTHPPIPKRLRFLDQLPL
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Pyrobaculum calidifontis and what are its key physiological characteristics?

Pyrobaculum calidifontis is a novel, facultatively aerobic, heterotrophic hyperthermophilic archaeon originally isolated from a terrestrial hot spring in the Philippines . This microorganism is characterized by rod-shaped cells measuring 1.5 to 10 micrometers in length and 0.5 to 1.0 micrometers in width . The organism demonstrates optimal growth at extremely high temperatures ranging from 90 to 95°C and at a neutral pH of approximately 7.0 when cultured in atmospheric air .

The metabolic versatility of P. calidifontis is particularly noteworthy. Under aerobic growth conditions, oxygen serves as the final electron acceptor, and vigorous agitation of the culture medium significantly enhances growth, indicating efficient oxygen utilization . Interestingly, elemental sulfur has been shown to inhibit cell growth under aerobic conditions, whereas thiosulfate stimulates proliferation . When grown anaerobically, P. calidifontis can utilize nitrate as a final electron acceptor, but cannot employ nitrite or sulfur-containing compounds such as elemental sulfur, thiosulfate, sulfate, or sulfite for this purpose . The genomic DNA of this archaeon has a G+C content of 51 mol% .

What is the general structure and function of HtpX proteases?

HtpX proteases are integral membrane metallopeptidases that play a crucial role in protein quality control mechanisms by preventing the accumulation of misfolded proteins in cellular membranes . Based on structural predictions and experimental evidence, HtpX is typically composed of four transmembrane segments with a catalytic domain positioned on the cytosolic side of the membrane . The first two transmembrane segments occur within the first 55 amino acid residues, while the latter two are generally located between residues 150-215, although the exact positioning of these latter segments remains somewhat controversial in the literature .

The catalytic machinery of HtpX proteases centers around the characteristic HEXXH zinc-binding motif, which is a hallmark of zinc-dependent metallopeptidases . Within this motif, two histidine residues (corresponding to H139 and H143 in E. coli HtpX) coordinate a zinc ion essential for catalytic activity . A third residue, typically a glutamic acid located in a "glutamate helix" spanning residues 220-230 after the fourth transmembrane segment, is predicted to complete the zinc coordination sphere . The glutamic acid within the HEXXH motif (E140 in E. coli) is proposed to function as a general base and acid during catalysis, aligning and activating the catalytic water molecule that attacks the peptide bond of the substrate .

Functional studies have demonstrated that HtpX proteases cleave only the cytoplasmic regions of membrane proteins, which aligns with the predicted cytosolic orientation of the catalytic domain . This spatial restriction of proteolytic activity is distinct from some other membrane proteases, such as Oma1, which can cleave substrates on both sides of the membrane .

What are the optimal storage and handling conditions for Recombinant Pyrobaculum calidifontis Protease HtpX homolog?

Optimal storage and handling conditions for Recombinant Pyrobaculum calidifontis Protease HtpX homolog are critical for maintaining protein stability and activity. The recommended storage buffer consists of a Tris-based buffer supplemented with 50% glycerol, specifically optimized for this protein's stability . For short-term storage, the protein should be maintained at -20°C, while extended storage periods require conservation at either -20°C or -80°C for maximum stability .

To preserve enzyme activity and prevent protein degradation, repeated freezing and thawing cycles should be strictly avoided . For ongoing experimental work, it is advisable to prepare working aliquots that can be stored at 4°C for up to one week to minimize freeze-thaw damage . This approach balances practical laboratory usage with preservation of protein integrity.

What methods are recommended for expression and purification of Recombinant Pyrobaculum calidifontis Protease HtpX?

Expression and purification of integral membrane proteins like the Pyrobaculum calidifontis Protease HtpX homolog present significant technical challenges. Based on successful strategies with homologous proteins, the following methodological approach is recommended:

Expression System Selection:
Several E. coli strains have been evaluated for expression of membrane-bound HtpX proteins, with BL21(DE3) demonstrating superior results for HtpX homologs . For hyperthermophilic proteins like those from P. calidifontis, codon optimization may be necessary to accommodate the different codon usage between archaeal and bacterial expression systems.

Vector Design Considerations:
A modified pET-derived vector attaching a C-terminal His8-tag has proven effective for HtpX expression . This configuration allows for minimal interference with protein folding while providing efficient purification capability. The addition of fusion partners such as MBP (Maltose Binding Protein) may enhance solubility, though this should be empirically tested for the P. calidifontis homolog .

Expression Protocol:
Culturing E. coli at reduced temperatures (16-20°C) after IPTG induction can enhance proper folding of membrane proteins . For thermostable proteins from hyperthermophiles, this counterintuitive approach often improves yield by slowing the translation rate and allowing proper membrane insertion before aggregation occurs.

Membrane Protein Extraction:
After cell lysis, typically performed using a microfluidizer or sonication in the presence of protease inhibitors, membrane fractions should be separated by ultracentrifugation . Octyl-β-D-glucoside has proven effective for solubilizing HtpX from membranes while maintaining protein structure and function .

Purification Strategy:
A three-step purification protocol has shown excellent results for HtpX homologs :

  • Cobalt-affinity chromatography using the His-tag

  • Anion-exchange chromatography for removal of contaminants

  • Size-exclusion chromatography for final polishing and buffer exchange

Throughout the purification process, maintaining the appropriate detergent concentration above its critical micelle concentration is essential for protein stability .

How can researchers address the self-cleavage issue with HtpX proteases during recombinant expression?

The self-cleavage phenomenon observed in wild-type HtpX proteases presents a significant challenge for researchers working with these enzymes. This autoproteolytic activity typically occurs during cell disruption and/or membrane solubilization with detergent, severely compromising protein yield and integrity . Several strategic approaches can be implemented to address this challenge:

Table 2.2.1: Comparison of HtpX Mutants for Preventing Self-Cleavage

MutationTarget FunctionEffect on StructureEffect on ActivitySuitability for Studies
H139FZinc coordinationAlters active siteComplete inactivationFunctional studies
E140ACatalytic base/acidPreserves active siteComplete inactivationStructural studies
E222Q/AZinc coordinationMinimal disruptionSignificant reductionComplementation studies

Expression Optimization:
Alternative approaches to minimize self-cleavage include:

  • Reducing expression temperature to slow protein synthesis and favor proper folding

  • Using specialized E. coli strains like C43(DE3) developed for toxic membrane protein expression

  • Incorporating fusion partners that can sterically hinder access to the cleavage site

Purification Under Modified Conditions:
Some researchers have successfully purified wild-type HtpX under denaturing conditions followed by refolding in the presence of metal chelators . While this approach prevents self-cleavage during purification, it introduces the challenge of ensuring proper refolding of a membrane protein, which can significantly impact the functional and structural integrity of the final product.

The E140A mutation strategy represents the optimal balance between maintaining native-like protein structure and preventing self-cleavage, making it the recommended approach for researchers working with P. calidifontis HtpX or other homologs .

What is the proposed catalytic mechanism of HtpX proteases and how does it compare to other metallopeptidases?

The catalytic mechanism of HtpX proteases follows fundamental principles shared among zinc-dependent metallopeptidases while exhibiting distinct characteristics related to its membrane-embedded nature. Based on structural and biochemical studies of HtpX and related proteases, the following mechanism has been proposed:

Active Site Architecture:
The HtpX active site features the characteristic HEXXH zinc-binding motif (where X represents any amino acid), with histidine residues at positions equivalent to H139 and H143 in E. coli HtpX coordinating the catalytic zinc ion . A third residue, likely a glutamic acid positioned within a "glutamate helix" following the fourth transmembrane segment (corresponding to E222 in E. coli), completes the zinc coordination sphere . This arrangement is similar to that observed in other metallopeptidases, including matrix metalloproteinases and thermolysin.

Catalytic Water Activation:
The glutamic acid residue within the HEXXH motif (E140 in E. coli) functions as a general base/acid during catalysis . This residue aligns and activates a water molecule, increasing its nucleophilicity for attack on the scissile peptide bond of the substrate . The activated water molecule generates a tetrahedral intermediate through nucleophilic attack on the carbonyl carbon of the peptide bond.

Substrate Binding and Specificity:
Unlike soluble metallopeptidases that can access substrates from multiple directions, HtpX appears to cleave only the cytoplasmic regions of membrane proteins, suggesting a spatially restricted substrate-binding pocket . This topological constraint likely contributes to substrate specificity and distinguishes HtpX from proteases like Oma1, which can cleave substrates on both sides of the membrane .

Comparative Analysis:
While HtpX shares the zinc-dependent hydrolysis mechanism with other metallopeptidases, several features distinguish it:

  • Membrane integration: Unlike soluble proteases, HtpX's active site exists in proximity to the membrane, potentially influencing substrate access and specificity.

  • Self-cleavage propensity: HtpX demonstrates pronounced autoproteolytic activity, particularly around position Leu260 in E. coli HtpX , suggesting either enhanced reactivity or limited regulation compared to many soluble metallopeptidases.

  • Thermal adaptation: The P. calidifontis HtpX homolog likely exhibits structural adaptations for catalysis at extremely high temperatures (90-95°C) , potentially including increased rigidity through disulfide bonding, ionic interactions, or hydrophobic packing.

Understanding the catalytic mechanism of P. calidifontis HtpX is particularly valuable for comparative enzymology, as it provides insights into how metallopeptidase mechanisms are adapted for function in hyperthermophilic conditions and within membrane environments.

What approaches are recommended for studying the substrate specificity of Pyrobaculum calidifontis Protease HtpX?

Determining the substrate specificity of Pyrobaculum calidifontis Protease HtpX requires specialized methodological approaches that account for both its membrane-bound nature and hyperthermophilic origin. The following comprehensive strategy is recommended:

In Vitro Peptide Library Screening:
Synthetic peptide libraries can be employed to identify preferred cleavage motifs. Given the thermostable nature of P. calidifontis proteins, these assays should be performed at elevated temperatures (60-90°C) to reflect native conditions . Fluorogenic or chromogenic peptide substrates with systematic variations in the P4-P4' positions allow rapid screening of sequence preferences. Activity measurements should be conducted in the presence of appropriate detergents to maintain HtpX in its native conformation .

Membrane Protein Substrate Identification:
Since HtpX homologs preferentially cleave cytoplasmic regions of membrane proteins , candidate substrate screening should focus on:

  • Heterologous expression of P. calidifontis membrane proteins with the HtpX protease

  • Mass spectrometry analysis of cleavage products to identify specific cut sites

  • Comparative proteomics between wild-type and HtpX-deficient P. calidifontis strains

For these approaches, catalytically active HtpX must be used, requiring careful optimization to minimize self-cleavage while maintaining sufficient activity for substrate processing .

Structural Modeling and Docking:
In silico approaches can complement experimental methods:

  • Homology modeling of P. calidifontis HtpX based on available structures of related proteins

  • Molecular docking simulations with potential substrate peptides

  • Molecular dynamics simulations at high temperatures to identify substrate-binding pocket adaptations specific to thermostable variants

Table 2.4.1: Methodological Approaches for Studying HtpX Substrate Specificity

MethodTechnical RequirementsAdvantagesLimitationsTemperature Considerations
Peptide library screeningSynthetic peptides, Fluorescence/spectrophotometerHigh-throughput, QuantitativeLimited to short peptidesMust be performed at 60-90°C
Proteomics analysisMass spectrometer, Protein separation techniquesIdentifies native substratesComplex data analysisNative conditions required
Structural modelingComputational resourcesProvides mechanistic insightsRequires validationCan simulate high temperatures
Site-directed mutagenesisMolecular biology toolsValidates binding pocketsLabor intensiveExpression may be challenging

Validation Through Mutagenesis:
Following identification of potential substrate recognition motifs or binding pockets, site-directed mutagenesis of both HtpX and putative substrates can validate the proposed interaction model. Key residues in the substrate-binding pocket can be mutated to alter specificity, while modifications to substrate sequences can confirm recognition requirements.

This multi-faceted approach accounts for the unique challenges presented by a membrane-bound metallopeptidase from a hyperthermophilic organism, providing a comprehensive understanding of its substrate preferences and recognition mechanisms.

How can researchers leverage the thermostability of Pyrobaculum calidifontis proteins for biotechnological applications?

The exceptional thermostability of proteins derived from Pyrobaculum calidifontis, which naturally thrives at temperatures between 90-95°C , presents unique opportunities for biotechnological applications. Researchers can exploit this thermal resilience through several strategic approaches:

Structural Basis of Thermostability:
Understanding the molecular determinants of thermostability in P. calidifontis HtpX provides a foundation for protein engineering. Thermostable proteins typically exhibit several adaptations:

  • Increased hydrophobic core packing

  • Enhanced electrostatic interactions and salt bridges

  • Higher proportion of amino acids with branched side chains

  • Reduced surface loop flexibility

  • Strategic disulfide bond formation

Comparative structural analysis between P. calidifontis HtpX and mesophilic homologs can identify specific stabilizing elements that can be transferred to other proteins of biotechnological interest.

High-Temperature Biocatalysis:
The HtpX protease from P. calidifontis may serve as an efficient biocatalyst for processes requiring high temperatures, offering several advantages:

  • Increased reaction rates: Elevated temperatures accelerate chemical reactions

  • Reduced microbial contamination: High temperatures minimize growth of contaminating microorganisms

  • Enhanced substrate solubility: Many hydrophobic compounds become more soluble at higher temperatures

  • Decreased viscosity: Facilitates better mixing and mass transfer

Applications may include processing of heat-resistant materials, degradation of recalcitrant proteins, or peptidomimetic synthesis at elevated temperatures.

Thermostable Expression System Development:
The genetic elements controlling P. calidifontis protein expression (promoters, ribosome binding sites, etc.) may be harnessed to develop expression systems optimized for thermophilic conditions. Such systems could enable:

  • In situ enzyme production in high-temperature industrial processes

  • Continuous biocatalysis in thermophilic bioprocesses

  • Development of thermostable protein production platforms

Chimeric Protein Engineering:
The thermostable domains of P. calidifontis HtpX can be fused with functional domains from mesophilic proteins to create chimeric enzymes with enhanced thermal stability while retaining desired catalytic properties. This domain-swapping approach may be particularly valuable for:

  • Creating heat-resistant versions of industrially important proteases

  • Developing thermostable reporter proteins for high-temperature processes

  • Engineering membrane proteins that maintain structural integrity at elevated temperatures

Table 2.5.1: Potential Biotechnological Applications of P. calidifontis HtpX

Application AreaSpecific UseTechnical AdvantagesDevelopment Challenges
BiocatalysisPeptide bond hydrolysis at high temperaturesIncreased reaction rates, Reduced contaminationSubstrate specificity limitation
Protein engineeringThermostabilization of mesophilic proteasesTransfer of stabilizing elementsMaintaining catalytic efficiency
Structural biologyModel for membrane protein thermostabilityInsights into extreme adaptationCrystallization difficulties
Bioprocess monitoringThermostable biosensorsFunction in extreme conditionsSignal transduction at high temperatures

The successful biotechnological exploitation of P. calidifontis HtpX requires interdisciplinary approaches combining structural biology, protein engineering, and bioprocess development to harness its unique thermostable properties while addressing the challenges associated with membrane protein manipulation.

What is the optimal experimental setup for characterizing the enzymatic activity of Pyrobaculum calidifontis Protease HtpX?

Characterizing the enzymatic activity of Pyrobaculum calidifontis Protease HtpX requires specialized experimental conditions that account for both its membrane-bound nature and hyperthermophilic origin. The following comprehensive methodology is recommended:

Buffer System and Temperature Optimization:
Given the hyperthermophilic nature of P. calidifontis, activity assays should be conducted at elevated temperatures, ideally between 70-95°C to reflect native conditions . Thermostable buffers such as PIPES, HEPES, or phosphate buffers at concentrations of 50-100 mM with pH adjusted to 7.0-7.5 at the operating temperature are recommended . Temperature stability of the buffer should be verified, as pH can shift significantly at high temperatures.

Detergent Selection:
As an integral membrane protein, HtpX requires appropriate detergents to maintain its native conformation during activity assays. Octyl-β-D-glucoside has proven effective for solubilizing HtpX homologs while preserving structural integrity . The detergent concentration should be maintained above its critical micelle concentration throughout the experiment. Alternative detergents such as DDM (n-dodecyl-β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) may also be evaluated for optimal activity preservation.

Activity Assay Design:
Several complementary approaches can be employed to measure HtpX activity:

  • Fluorogenic peptide substrates: Short peptides (8-12 amino acids) containing a fluorophore/quencher pair that releases a fluorescent signal upon cleavage. These should be designed based on predicted substrate preferences of HtpX.

  • FRET-based assays: Proteins labeled with fluorescent donor/acceptor pairs can monitor conformational changes or cleavage events in real-time.

  • Gel-based assays: Incubation of HtpX with potential protein substrates followed by SDS-PAGE analysis to visualize cleavage products. This approach requires thermostable substrate proteins.

Table 3.1.1: Recommended Experimental Conditions for P. calidifontis HtpX Activity Assays

ParameterRecommended ConditionRationaleMonitoring Method
Temperature80-95°CMatches native growth conditionsThermostable temperature probe
pH7.0-7.5Optimal for P. calidifontis growthpH electrode calibrated for high temperatures
Buffer50 mM PIPES or phosphateStability at high temperaturesPre-testing of pH stability
Detergent1% Octyl-β-D-glucosideMaintains membrane protein structureAbove CMC (0.7%)
Metal ions0.1-1 mM ZnCl₂Ensures metalloprotease activityICP-MS verification
Reducing agent1-5 mM DTT or TCEPPrevents oxidation at high temperaturesEllman's reagent

Controls and Validation:
Essential controls include:

  • Catalytically inactive mutant (E140A) to confirm specificity of observed activity

  • Metal chelators (EDTA, 1,10-phenanthroline) to verify zinc-dependent activity

  • Time-course experiments to establish reaction kinetics

  • Heat-inactivated enzyme to distinguish enzymatic from non-enzymatic degradation at high temperatures

By implementing this carefully designed experimental approach, researchers can accurately characterize the enzymatic properties of P. calidifontis HtpX while addressing the unique challenges associated with thermostable membrane-bound metalloproteases.

What strategies should researchers employ for comparative analysis of HtpX from hyperthermophiles versus mesophiles?

Conducting comparative analyses between HtpX proteases from hyperthermophiles like Pyrobaculum calidifontis and mesophilic counterparts requires a multi-faceted experimental approach to elucidate the adaptations underlying thermostability while maintaining similar catalytic functions. The following comprehensive strategy is recommended:

Selection of Comparative Systems:
Researchers should select a representative panel of HtpX orthologs spanning a broad temperature range:

  • Hyperthermophiles: P. calidifontis (optimal growth: 90-95°C)

  • Thermophiles: Thermoanaerobacter tengcongensis (optimal growth: 75-80°C)

  • Moderate thermophiles: Aquifex aeolicus (optimal growth: 85-95°C)

  • Mesophiles: Escherichia coli (optimal growth: 37°C)

Sequence-Structure-Function Analysis:
A systematic approach should begin with bioinformatic analysis:

  • Multiple sequence alignment: Identify conserved catalytic residues versus variable regions that may contribute to thermostability.

  • Homology modeling: Generate structural models of each ortholog to visualize potential thermostabilizing features.

  • Molecular dynamics simulations: Conduct simulations at different temperatures to analyze conformational stability and flexibility differences.

Experimental Thermal Stability Assessment:
Multiple complementary methods should be employed to quantify thermal stability differences:

  • Differential scanning calorimetry (DSC): Determine melting temperatures (Tm) and unfolding enthalpies.

  • Circular dichroism (CD) spectroscopy: Monitor secondary structure changes during thermal denaturation.

  • Intrinsic fluorescence: Track tertiary structure changes at increasing temperatures.

  • Thermal inactivation kinetics: Measure the rate of activity loss at various temperatures.

Table 3.2.1: Comparative Analysis Parameters for HtpX Orthologs

Analysis ParameterExperimental ApproachExpected DifferencesInterpretation
Melting temperature (Tm)DSC, CD thermal meltHigher Tm for hyperthermophilesThermodynamic stability
Unfolding cooperativityDSC peak widthBroader peaks for hyperthermophilesStructural rigidity
Activation energyArrhenius plotsHigher Ea for hyperthermophilesKinetic stability
Temperature optimaActivity vs. temperatureShifted curvesCatalytic adaptation
Conformational flexibilityH/D exchange, MD simulationsReduced flexibility in hyperthermophilesMolecular rigidity

Catalytic Efficiency Comparison:
To distinguish between thermal adaptation and catalytic properties:

  • Temperature dependence of activity: Measure enzyme activity across a broad temperature range (20-100°C) for each ortholog.

  • Substrate specificity profiling: Compare cleavage preferences using peptide libraries at each enzyme's optimal temperature.

  • Kinetic parameter determination: Calculate kcat and Km values at standardized relative temperatures (Topt, Topt-10°C, Topt-20°C).

Structural Basis of Thermostability:
To identify specific adaptations:

  • Site-directed mutagenesis: Create chimeric enzymes by swapping domains or introducing specific residues between thermophilic and mesophilic versions.

  • Crystallography or cryo-EM: If possible, determine high-resolution structures to directly observe stabilizing interactions.

  • Disulfide bond analysis: Compare the number and positioning of disulfide bridges that may contribute to thermostability.

This integrated approach will provide comprehensive insights into how HtpX proteases from hyperthermophiles like P. calidifontis have evolved enhanced thermostability while maintaining the core catalytic mechanisms shared with mesophilic homologs. The findings may reveal generalizable principles of protein thermostabilization that could be applied to other enzymes of biotechnological interest.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.