Recombinant Pyrobaculum calidifontis UPF0290 protein Pcal_2086 (Pcal_2086)

What is Pyrobaculum calidifontis and why is it significant for protein research?

Pyrobaculum calidifontis is a novel, facultatively aerobic, heterotrophic hyperthermophilic archaeon first isolated from a terrestrial hot spring in the Philippines. This archaeon (strain VA1) is rod-shaped with a length of 1.5 to 10 μm and a width of 0.5 to 1.0 μm . Its significance for protein research stems from its extreme growth conditions - optimally at 90-95°C and pH 7.0 under atmospheric air, making it an excellent model organism for studying thermostable proteins .

P. calidifontis exhibits several noteworthy physiological characteristics that differentiate it from other Pyrobaculum species:

The thermostable proteins from P. calidifontis, including Pcal_2086, provide valuable insights into protein folding, stability, and function under extreme conditions, making them excellent subjects for both basic and applied research .

What is currently known about the structure and potential function of UPF0290 protein Pcal_2086?

UPF0290 protein Pcal_2086 is a protein of unknown function (as indicated by the UPF designation) from P. calidifontis. Based on available information, we know the following structural features:

• Complete amino acid sequence: MNEIVQLFLLIWPPYVANGSAVLAARLRRRHPLDFGKNFLDGRRIFGDGKTFEGVAIGVSAGTLLGYAPNLAYSYLTLLDAFLLATAAIVGDLLGAFVKRRLCMPRGYPAFPLDQLDFLMALLVYSLYRELHIPLLLAAVVLTPVIHRATNYAAYKLRLKKEPW

• Expression region: 1-165 amino acids

• UniProt accession number: A3MXY4

While the specific function of Pcal_2086 remains uncharacterized, structural prediction methods suggest it may contain membrane-associated regions (indicated by the hydrophobic amino acid clusters in its sequence) and potential DNA/RNA binding motifs (suggested by the presence of positively charged residues) . Comparative analysis with other archaeal proteins suggests it may play a role in cellular adaptation to extreme temperatures, potentially in membrane integrity or gene regulation.

What are the optimal protocols for handling and storing recombinant Pcal_2086 protein?

Handling thermostable proteins like Pcal_2086 requires specific protocols to maintain activity and stability. Based on manufacturer recommendations and standard practices for hyperthermophilic proteins:

Storage conditions:

• Store at -20°C for regular use

• For extended storage, conserve at -20°C or -80°C

• Store in Tris-based buffer with 50% glycerol optimized for this protein

Handling recommendations:

• Avoid repeated freezing and thawing cycles as this can compromise protein integrity

• Store working aliquots at 4°C for up to one week

• When conducting experiments, maintain temperature control appropriate to the assay

Quality control measures:

• Verify protein integrity using SDS-PAGE before experiments

• For functional assays, consider the extreme temperature preference of the native organism (90-95°C)

• Include appropriate controls when testing enzymatic activities

These handling protocols are designed to maintain the native conformation and potential activity of the recombinant protein for research applications.

What expression systems have proven most effective for recombinant production of thermostable proteins like Pcal_2086?

For successful expression of hyperthermophilic archaeal proteins like those from P. calidifontis, researchers have developed specialized approaches. While not specific to Pcal_2086, studies on other P. calidifontis proteins provide methodological guidance:

Expression systems used for P. calidifontis proteins:

• E. coli has been successfully used to express thermostable proteins like the P. calidifontis hexokinase (Pcal-HK) in soluble and active form

• The reverse gyrase from P. calidifontis (PcalRG) was also expressed in E. coli systems

Methodological considerations:

• Codon optimization: Adjusting for E. coli codon bias can significantly improve expression

• Temperature modulation: Lowering expression temperature (16-25°C) often improves folding of thermostable proteins

• Solubility tags: Fusion partners like SUMO, MBP, or thioredoxin can enhance solubility

• Specialized E. coli strains: Strains like Rosetta, Arctic Express, or C41/C43 are designed for difficult proteins

Purification approach:
Typically, a multi-step purification process is recommended, beginning with heat treatment (taking advantage of the thermostability) followed by conventional chromatography methods .

What bioinformatic approaches can help predict the function of poorly characterized proteins like Pcal_2086?

For proteins of unknown function like Pcal_2086, computational methods provide valuable insights toward functional characterization:

Sequence-based approaches:

• BLAST and PSI-BLAST searches against characterized proteins

• Multiple sequence alignment with UPF0290 family proteins

• Identification of conserved domains and motifs using Pfam, PROSITE, and InterPro

• Detection of signal peptides and transmembrane regions using SignalP and TMHMM

Structure-based predictions:

• Secondary structure prediction using PSIPRED or JPred

• Tertiary structure modeling using AlphaFold2 or I-TASSER

• Structural comparison with characterized proteins using DALI or TM-align

• Active site prediction based on structural conservation

Genomic context analysis:

• Gene neighborhood examination to identify functionally related genes

• Co-expression analysis where transcriptomic data is available

• Phylogenetic profiling to identify co-evolving gene families

These computational approaches provide testable hypotheses about protein function that can guide subsequent experimental design for functional characterization.

How can researchers design functional assays for proteins of unknown function like Pcal_2086?

Designing functional assays for uncharacterized proteins like Pcal_2086 requires a systematic approach combining computational predictions with experimental validation:

Step-wise experimental approach:

• Preliminary bioinformatic analysis:

  • Identify potential structural domains

  • Predict possible biochemical activities based on sequence motifs

  • Analyze genomic context for functional insights

• Activity screening panels:

  • Test for common enzymatic activities (hydrolase, transferase, etc.)

  • Assess nucleic acid binding capabilities through EMSAs

  • Evaluate membrane interaction through liposome binding assays

• Protein interaction studies:

  • Pull-down assays with cellular extracts from P. calidifontis

  • Yeast two-hybrid screens with genomic libraries

  • Cross-linking followed by mass spectrometry (XL-MS)

• Phenotypic analysis:

  • Heterologous expression in model organisms

  • Gene knockout/knockdown where genetic systems exist

  • Overexpression studies to identify cellular effects

Case example methodology:
Studies on PcalRG from P. calidifontis illustrate a methodical approach to functional characterization. Researchers first identified domain architecture through bioinformatics, then designed specific assays for predicted activities (DNA binding, ATP hydrolysis, topoisomerase activity). This led to the discovery of novel activities including ATP-dependent unwinding of Holliday junctions and single-strand DNA annealing .

What structural features typically contribute to protein thermostability in archaeal proteins from P. calidifontis?

Proteins from hyperthermophiles like P. calidifontis employ several structural adaptations to maintain stability at extreme temperatures. Based on studies of characterized P. calidifontis proteins such as Pcal-HK and PcalRG, the following features are typically observed:

Key thermostabilizing features:

Experimental evidence:
The hexokinase from P. calidifontis (Pcal-HK) demonstrates exceptional thermostability, maintaining activity at 90-95°C. Analysis revealed a monomeric structure with metal ion dependency (particularly Mg²⁺), suggesting that metal coordination contributes significantly to its thermostability .

Similarly, the reverse gyrase (PcalRG) maintains activity at temperatures up to 100°C, showing processive enzymatic activity even under these extreme conditions, indicating highly optimized structural adaptations .

What experimental approaches have been successful in characterizing other thermostable proteins from P. calidifontis?

Studies on well-characterized P. calidifontis proteins provide methodological frameworks applicable to Pcal_2086 research:

Case study 1: Pcal-HK (Hexokinase)
The ROK family hexokinase from P. calidifontis was characterized through:

• Heterologous expression in E. coli

• Purification yielding soluble, active protein

• Functional assays demonstrating broad substrate specificity (glucose, glucosamine, N-acetyl glucosamine, fructose, mannose)

• Determination of optimal conditions: 90-95°C, pH 8.5, metal ion dependence

• Kinetic parameter determination at 90°C showing similar catalytic efficiency toward various hexoses

Case study 2: PcalRG (Reverse Gyrase)
The reverse gyrase characterization involved:

• Cloning and expression in E. coli

• Purification of the untagged protein

• DNA binding assays showing preference for ssDNA and substrates with single-stranded tails

• Topoisomerase activity assays demonstrating ATP-dependent positive supercoiling

• Analysis of DNA unwinding and annealing activities

• Evaluation of ATP's modulatory role in multiple activities

Methodological innovations:

• Temperature-controlled reaction vessels for high-temperature enzymatic assays

• Modified gel electrophoresis systems for analyzing DNA-protein interactions at extreme conditions

• Two-dimensional agarose gel electrophoresis for separating positive and negative plasmid topoisomers

• Specialized buffers and reaction conditions mimicking the physiological environment of P. calidifontis

These methodologies provide a blueprint for characterizing novel proteins like Pcal_2086 from hyperthermophilic organisms.

How can site-directed mutagenesis be applied to investigate key residues in Pcal_2086?

Site-directed mutagenesis is a powerful approach for investigating structure-function relationships in proteins like Pcal_2086. A systematic mutagenesis strategy would include:

Strategic approach for Pcal_2086:

• Target selection based on computational analysis:

  • Conserved residues across UPF0290 family proteins

  • Predicted functional motifs or domains

  • Residues in hypothesized active sites or binding pockets

  • Amino acids potentially involved in thermostability

• Types of mutations to consider:

  • Conservative substitutions to probe specific interactions

  • Alanine scanning to identify essential residues

  • Introduction of charged residues to test electrostatic hypotheses

  • Cysteine mutations for subsequent chemical modification studies

• Functional impact assessment:

  • Comparative stability analysis (thermal denaturation assays)

  • Activity assays (once function is identified)

  • Structural analysis of mutants (CD spectroscopy, limited proteolysis)

  • Binding studies with potential interaction partners

Case study example:
In research on P. calidifontis reverse gyrase (PcalRG), site-directed mutagenesis of the putative catalytic tyrosine in the C-terminal domain (PcalRG-Y966F) eliminated topoisomerase and DNA nicking activity while preserving DNA binding capacity . This approach confirmed the catalytic mechanism and identified essential residues.

For Pcal_2086, a similar approach could target hydrophobic residues potentially involved in membrane association or charged residues potentially involved in nucleic acid binding, based on sequence analysis.

What techniques are most effective for studying protein-protein interactions involving thermostable proteins like Pcal_2086?

Studying protein-protein interactions (PPIs) for thermostable proteins presents unique challenges requiring specialized approaches:

Methodological considerations for hyperthermophilic protein interactions:

• In vitro interaction assays:

  • Pull-down assays using thermostable tagged proteins

  • Surface Plasmon Resonance (SPR) at elevated temperatures

  • Isothermal Titration Calorimetry (ITC) with temperature-controlled cells

  • Microscale Thermophoresis (MST) for thermostable complex detection

• Cross-linking approaches:

  • Chemical cross-linking combined with mass spectrometry (XL-MS)

  • Photo-activatable cross-linkers for capturing transient interactions

  • In vivo cross-linking in heterologous hosts

• Structural techniques:

  • Cryo-electron microscopy (cryo-EM) for complex visualization

  • X-ray crystallography of co-crystallized proteins

  • NMR studies with temperature-resistant labeled proteins

• Computational predictions:

  • Protein-protein docking simulations

  • Molecular dynamics at elevated temperatures

  • Co-evolution analysis to predict interaction interfaces

Experimental temperature considerations:
For P. calidifontis proteins, interactions should ideally be studied at physiologically relevant temperatures (80-95°C). When technically challenging, researchers often use a dual approach:

• Room temperature assays to identify potential interactions

• Validation of positive hits at elevated temperatures using specialized equipment

• Control experiments with thermostable proteins of known interaction patterns

This approach has been successful in characterizing interaction networks in other hyperthermophiles and could be applied to study Pcal_2086's potential interaction partners.

How do the expression patterns of proteins like Pcal_2086 change under different growth conditions in P. calidifontis?

Understanding expression regulation of proteins in extremophiles provides insights into their physiological roles. For studying P. calidifontis proteins like Pcal_2086:

Methodological approaches:

• Transcriptomic analysis:

  • RNA sequencing under varied growth conditions

  • Quantitative RT-PCR for targeted gene expression analysis

  • Transcriptional start site mapping to identify regulatory elements

• Proteomic approaches:

  • Shotgun proteomics under different growth conditions

  • Stable isotope labeling (SILAC) for quantitative comparison

  • Protein turnover analysis using pulse-chase methods

• Key conditions to investigate:

  • Temperature variations (sub-optimal vs. optimal)

  • Oxygen availability (aerobic vs. anaerobic with nitrate)

  • Nutrient limitations

  • Growth phase differences (exponential vs. stationary)

Research insights from P. calidifontis studies:
Studies on P. calidifontis have shown that oxygen serves as the final electron acceptor under aerobic growth conditions, and vigorous shaking of the medium significantly enhances growth . Under anaerobic conditions, nitrate can serve as an electron acceptor, while elemental sulfur inhibits growth under aerobic conditions . These physiological adaptations suggest complex regulatory networks that likely influence the expression of membrane and metabolic proteins like Pcal_2086.

A comparative analysis approach might examine:

What computational modeling approaches can predict the three-dimensional structure of Pcal_2086?

Modern computational tools can provide valuable structural insights for proteins like Pcal_2086 even in the absence of experimental structures:

Comprehensive structural prediction workflow:

• Template-based modeling:

  • Identification of structural homologs through HHpred or SWISS-MODEL

  • Multiple-template modeling using Modeller

  • Quality assessment using MolProbity and PROCHECK

• Deep learning approaches:

  • AlphaFold2 or RoseTTAFold for ab initio structure prediction

  • Confidence score analysis for model evaluation

  • Ensemble modeling to account for structural variability

• Molecular dynamics simulations:

  • High-temperature MD simulations to assess thermostability

  • Identification of stable structural elements and flexible regions

  • Solvent accessibility analysis to identify potential binding sites

• Functional site prediction:

  • CASTp for pocket and cavity detection

  • ConSurf for evolutionary conservation mapping

  • Electrostatic surface potential calculation using APBS

Special considerations for thermostable proteins:
Computational modeling of hyperthermophilic proteins requires attention to unique structural features:

• Enhanced salt bridge networks

• Compact hydrophobic cores

• Minimized surface loops

• Optimized electrostatic interactions

A comparative modeling approach with other characterized proteins from P. calidifontis could provide additional insights into thermostabilizing structural features relevant to Pcal_2086.

What challenges exist in crystallizing proteins from hyperthermophiles like P. calidifontis?

Obtaining high-resolution structural data for hyperthermophilic proteins presents unique challenges and opportunities:

Major challenges in crystallization:

• Conformational stability issues:

  • Proteins evolved for high temperatures may exhibit flexibility at room temperature

  • Multiple conformational states can impede crystal formation

  • Solution conditions must be carefully optimized to mimic native environment

• Buffer and precipitant considerations:

  • Standard crystallization conditions may not maintain native structure

  • Specialized additives may be required to promote stable crystal contacts

  • Temperature-dependent solubility behavior differs from mesophilic proteins

• Technical hurdles:

  • Crystallization trials may need to be conducted at elevated temperatures

  • Specialized equipment for high-temperature crystal growth

  • Challenges in flash-cooling crystals grown at high temperatures

Innovative approaches:

• Surface entropy reduction through targeted mutations

• Crystallization chaperones or antibody fragments to stabilize specific conformations

• Lipidic cubic phase crystallization for membrane-associated proteins

• In situ serial crystallography at elevated temperatures

Successful strategies from related studies:
While specific crystallization methods for P. calidifontis proteins aren't detailed in the search results, successful approaches for other hyperthermophilic proteins have included:

• Initial screening at both room temperature and elevated temperatures

• Inclusion of physiologically relevant ions (e.g., Mg²⁺)

• Truncation of flexible regions identified through limited proteolysis

• Co-crystallization with binding partners or substrates

These approaches could be adapted for structural studies of Pcal_2086.

How can comparative genomics illuminate the evolutionary history and potential function of Pcal_2086?

Comparative genomics provides powerful insights into the evolution and function of uncharacterized proteins like Pcal_2086:

Comprehensive comparative genomics workflow:

• Ortholog identification across archaeal genomes:

  • Reciprocal BLAST searches to identify orthologs

  • Synteny analysis to examine gene neighborhood conservation

  • Protein family classification using OrthoMCL or similar tools

• Phylogenetic analysis:

  • Multiple sequence alignment of UPF0290 family proteins

  • Phylogenetic tree construction using maximum likelihood methods

  • Reconciliation with species trees to identify duplication/loss events

• Genomic context examination:

  • Analysis of consistently co-occurring genes

  • Detection of operonic structures across species

  • Identification of regulatory elements in promoter regions

• Evolutionary rate analysis:

  • Calculation of dN/dS ratios to detect selection pressures

  • Identification of conserved vs. variable regions

  • Coevolution analysis to predict functional interactions

Insights from P. calidifontis comparative genomics:
P. calidifontis belongs to the Pyrobaculum genus, which includes diverse species with varying physiological characteristics:

• P. islandicum and P. organotrophum are strict anaerobes

• P. aerophilum is a marine facultative microaerobe

• P. arsenaticum is a strict anaerobe

• P. oguniense is a facultative aerobe

This physiological diversity within a single genus provides an excellent framework for investigating the evolution of metabolic and structural adaptations, potentially revealing functional insights for proteins like Pcal_2086.

What methodological approaches can determine if Pcal_2086 plays a role in thermoadaptation?

Investigating the potential role of Pcal_2086 in thermoadaptation requires a multi-faceted approach:

Experimental strategy:

• Expression analysis under thermal stress:

  • qRT-PCR to measure transcript levels at different temperatures

  • Proteomics to quantify protein abundance in response to temperature shifts

  • Reporter gene assays to study promoter activity under thermal stress

• Genetic manipulation approaches:

  • Gene deletion/silencing where genetic systems exist

  • Heterologous expression in mesophilic hosts with temperature challenge

  • Complementation studies with orthologs from mesophilic organisms

• Biochemical characterization:

  • Thermal denaturation profiles (DSC, CD spectroscopy)

  • Activity assays (once function is identified) across temperature range

  • Protein-lipid interaction studies if membrane association is suspected

• Structural analysis under different temperatures:

  • MD simulations at varying temperatures

  • HDX-MS to identify temperature-sensitive regions

  • SAXS analysis to detect temperature-dependent conformational changes

Comparative methodology:
Studies on other P. calidifontis proteins, such as the reverse gyrase (PcalRG), demonstrate the importance of assessing activity across temperature ranges. PcalRG showed increased positive supercoiling activity with rising temperature, with significant activity even at 100°C, suggesting a direct role in thermal adaptation .

Similar rigorous temperature-dependent analysis of Pcal_2086 properties (stability, potential activity, interactions) could reveal its contribution to the hyperthermophilic lifestyle of P. calidifontis.

What are the most promising research directions for further characterizing Pcal_2086?

Based on the available data and methodological approaches discussed above, several high-priority research directions emerge for Pcal_2086:

• Functional characterization:

  • Systematic activity screening based on structural predictions

  • Interaction partner identification using pull-down and crosslinking approaches

  • Localization studies to determine cellular distribution

• Structural biology:

  • High-resolution structure determination (X-ray crystallography or cryo-EM)

  • Solution structure analysis using SAXS or NMR

  • Computational modeling validated by experimental data

• Physiological role assessment:

  • Gene expression analysis under varied growth conditions

  • Genetic manipulation where systems exist

  • Heterologous expression with functional complementation tests

• Evolutionary analysis:

  • Comprehensive phylogenetic studies of UPF0290 family proteins

  • Selection pressure analysis across archaeal lineages

  • Structural conservation mapping to identify functionally important regions

The exceptional properties of other P. calidifontis proteins, such as the robustness of PcalRG and the thermal activity of Pcal-HK, suggest that Pcal_2086 may likewise possess unique and valuable properties for both basic research and biotechnological applications .

How might research on Pcal_2086 contribute to our broader understanding of protein evolution and extremophilic adaptations?

Research on proteins like Pcal_2086 from extremophiles has implications that extend far beyond understanding a single protein:

Scientific significance:

• Evolutionary insights:

  • Understanding convergent evolution of thermostability across protein families

  • Elucidating the minimal genetic requirements for life at extreme temperatures

  • Tracking the evolutionary history of archaeal lineages through protein evolution

• Structural biology advancement:

  • Identifying novel thermostabilizing structural motifs

  • Understanding fundamental principles of protein folding and stability

  • Developing improved computational models for protein structure prediction

• Systems biology of extremophiles:

  • Building comprehensive networks of protein interactions in hyperthermophiles

  • Understanding global cellular responses to extreme conditions

  • Identifying essential vs. adaptive features for life at high temperatures

The remarkable adaptations of P. calidifontis, growing optimally at 90-95°C with facultative aerobic metabolism, represent an important model system for understanding life at environmental extremes . Detailed characterization of its constituent proteins, including Pcal_2086, contributes to our fundamental understanding of biochemical adaptation and the limits of biological systems.