Recombinant Pyrobaculum islandicum Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Introduction to Pyrobaculum islandicum and Undecaprenyl-diphosphatase

Pyrobaculum islandicum is a remarkable hyperthermophilic archaeon found predominantly in terrestrial hydrothermal environments. This organism demonstrates considerable metabolic diversity, utilizing iron, thiosulfate, and elemental sulfur for anaerobic respiration, making it an environmentally significant microorganism with distinctive physiological capabilities . The ubiquity of Pyrobaculum species in these extreme environments and their metabolic flexibility have made them valuable subjects for physiological and ecological studies.

Undecaprenyl-diphosphatase (uppP) belongs to a family of enzymes that catalyze the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate, a critical carrier lipid involved in peptidoglycan synthesis. In bacterial systems, these enzymes play significant roles in cell wall biosynthesis and, notably, have been implicated in resistance mechanisms against certain antimicrobials, particularly bacitracin . The recombinant form of P. islandicum uppP provides researchers with a stable, isolated version of this enzyme for detailed biochemical and structural characterization.

Comparative Analysis of uppP Across Species

The structural and functional characteristics of uppP exhibit both conservation and variation across different microbial species. The table below summarizes key comparative features based on available research data:

CharacteristicP. islandicum uppPE. faecalis uppPE. coli BacA-type UppP
Structural motifNot specifically documentedHydrophobic protein with eight transmembrane helices Hydrophobic protein with eight transmembrane helices
Expression patternNot specifically documentedConstitutive expression, not affected by bacitracin or cell wall-active antimicrobials Regulated expression
Role in antimicrobial resistanceNot specifically documentedConfers low-level bacitracin resistance Associated with bacitracin resistance
Enzymatic activityDephosphorylation of undecaprenyl pyrophosphateDephosphorylation of undecaprenyl pyrophosphate Dephosphorylation of undecaprenyl pyrophosphate

Biochemical Analysis of P. islandicum

Pyrobaculum islandicum possesses distinctive biochemical characteristics that distinguish it from other microorganisms, particularly in its mechanisms for anaerobic respiration. These properties provide context for understanding the potential functional significance of uppP in this organism.

Respiratory Mechanisms and Enzymatic Activities

P. islandicum demonstrates several unique features in its respiratory capabilities. Unlike some related species, it requires direct contact with insoluble iron oxide for growth and does not produce detectable extracellular compounds when grown on insoluble iron . Furthermore, P. islandicum lacks 2,6-anthrahydroquinone disulfonate oxidase activity, which sets it apart from other Pyrobaculum species such as P. aerophilum .

A particularly notable characteristic of P. islandicum is that its iron reduction pathway appears to be completely independent of c-type cytochromes . This represents a significant divergence from the iron reduction mechanisms observed in mesophilic bacteria like Shewanella and Geobacter, which typically utilize c-type cytochromes for electron transfer to iron oxides.

Enzymatic Response to Growth Conditions

Analysis of P. islandicum's enzymatic activities under various growth conditions reveals important regulatory patterns. NADH-dependent ferric reductase activity increases significantly (seven- to eightfold higher) in iron-grown cells compared to those grown on thiosulfate . This substantial upregulation suggests a responsive metabolic adaptation to environmental conditions, with the highest specific activities measured in the cytoplasmic fraction .

The table below summarizes key enzymatic activities in P. islandicum under different growth conditions:

Enzyme ActivityIron-grown CellsThiosulfate-grown CellsLocalization
NADH-dependent ferric reductase7-8× higherBaseline activityHighest in cytoplasmic fraction
AHDS oxidaseLowLowNo significant activity
Membrane protein compositionNo major unique bands120 kDa band (thiosulfate reductase)Membrane fraction

Potential Role of uppP in Antimicrobial Resistance

While specific information about the role of uppP in P. islandicum's antimicrobial resistance mechanisms is not directly addressed in the available research, studies on related enzymes in other organisms provide valuable insights. Research on UppP in Enterococcus faecalis demonstrates a clear connection between this enzyme and bacitracin resistance.

Insights from E. faecalis UppP Studies

In E. faecalis, uppP mutants exhibited significantly increased susceptibility to bacitracin (MICs=3-6 mg/L) compared to wild-type strains (MICs=32-48 mg/L) . Conversely, when uppP was overexpressed in a wild-type background, bacitracin resistance increased dramatically, with MICs rising to 128-≥256 mg/L . These findings establish a direct correlation between uppP activity and bacitracin resistance levels.

Importantly, the role of uppP appears to be specific to bacitracin resistance, as MICs for other antimicrobials (including cefoxitin, teicoplanin, vancomycin, gentamicin, enrofloxacin, and d-cycloserine) remained unaltered in the uppP mutant relative to the wild-type . This specificity suggests a targeted mechanism of resistance rather than a generalized stress response.

Potential Implications for P. islandicum

While direct experimental evidence for P. islandicum uppP's role in antimicrobial resistance is not documented in the available research, the conservation of this enzyme across diverse bacterial and archaeal species suggests potential functional parallels. The ability of P. islandicum to thrive in extreme environments may involve specialized adaptations of cellular components, including possible modifications to cell wall biosynthesis pathways in which uppP participates.

Growth Characteristics and Environmental Adaptations

P. islandicum demonstrates remarkable adaptability to various environmental conditions, with distinct growth characteristics observed across different pH levels and reduction potentials. These properties may influence the functional context in which uppP operates within the cellular machinery.

pH and Redox Dependencies

Growth patterns of P. islandicum vary significantly with the terminal electron acceptor used. Growth on elemental sulfur (S⁰) occurs optimally at pH 5-7, while growth on thiosulfate is optimal at pH 6-8 . In contrast, growth on iron compounds (both Fe(III) citrate and Fe(III) oxide hydroxide) is supported across a broader pH range of 6-9 . These differential pH optima suggest specialized adaptations for various respiratory pathways.

The table below summarizes the growth characteristics of P. islandicum under various environmental conditions:

Growth ConditionpH RangeOptimal pHDirect Contact RequirementDoubling Time
Elemental sulfur (S⁰)5-75-6Required 4.4 h (k=0.16 h⁻¹±0.02 h⁻¹)
Thiosulfate6-86-7Not documented3.1 h (k=0.22 h⁻¹±0.05 h⁻¹)
Fe(III) citrate6-97-9Not required5.6 h (k=0.12 h⁻¹±0.04 h⁻¹)
Fe(III) oxide hydroxide6.2-97-9Required 4.7 h (k=0.15 h⁻¹±0.05 h⁻¹)

Research Applications and Future Directions

The recombinant form of P. islandicum uppP represents a valuable research tool for investigating fundamental aspects of cell wall biosynthesis, antimicrobial resistance mechanisms, and archaeal biochemistry. Its availability as a commercial product facilitates various experimental applications .

Potential Research Applications

  1. Structural Studies: Recombinant P. islandicum uppP provides material for detailed structural analysis, potentially revealing adaptations that enable function under extreme thermophilic conditions.

  2. Antimicrobial Development: Understanding the role of uppP in cell wall biosynthesis and antimicrobial resistance could inform the development of novel therapeutic approaches targeting this pathway.

  3. Evolutionary Analysis: Comparative studies of uppP across bacteria and archaea may provide insights into the evolution of cell wall biosynthesis pathways and antimicrobial resistance mechanisms.

  4. Biotechnological Applications: The thermostable nature of enzymes from hyperthermophilic organisms like P. islandicum makes them potentially valuable in biotechnological applications requiring stability under extreme conditions.

Knowledge Gaps and Future Research

Several areas warrant further investigation to enhance our understanding of P. islandicum uppP:

  1. Structural Characterization: Detailed structural analysis of P. islandicum uppP, particularly examining adaptations that enable function at high temperatures.

  2. Antimicrobial Sensitivity: Direct experimental assessment of the relationship between uppP activity and antimicrobial resistance in P. islandicum.

  3. Regulatory Mechanisms: Investigation of potential regulatory mechanisms controlling uppP expression in response to environmental conditions and stress factors.

  4. Enzymatic Properties: Comprehensive biochemical characterization of the recombinant enzyme, including kinetic parameters, substrate specificity, and thermal stability profiles.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on your location and the purchase method. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. You may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please let us know, and we will prioritize its development.
Synonyms
uppP; Pisl_0122; Undecaprenyl-diphosphatase; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3)
Target Names
uppP
Target Protein Sequence
MDFLTAIVLGVVQGVSEWLPISSKTQVMFVSQLLLSATPELAYSLGLFLEAASVLAALIY FRLVYLKILRGFLGDAEGRKWLTYVIVTTAATGAVGIPLYMAAKRYLLLGASAGWLMVVL GVAVIFNAVLLQRARSVAGLKTFDDMTLGHMALVGLAQALSVLPGISRSGITTTTLLLLG YRPDEAFKSSFVLVPIAGLGATALAYLSEGGAVATPEVITAMLIGLVVSLVTIKALLEFA KSKHVTLVNIVVGTLAIAGGITRILLSS
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP).
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its function in Pyrobaculum islandicum?

Undecaprenyl-diphosphatase (uppP), also known as Undecaprenyl pyrophosphate phosphatase (EC 3.6.1.27), is a membrane protein involved in cell wall biosynthesis. In Pyrobaculum islandicum, this enzyme functions similarly to other bacterial UppPs by recycling undecaprenyl pyrophosphate to undecaprenyl phosphate, which is essential for peptidoglycan synthesis . The protein plays a critical role in maintaining cell wall integrity under the extreme growth conditions that P. islandicum experiences as a hyperthermophilic archaeon.

What are the optimal conditions for expressing recombinant P. islandicum uppP?

For optimal expression of recombinant P. islandicum uppP, researchers should consider the extreme thermophilic nature of the native organism. P. islandicum grows optimally at 95°C under anaerobic conditions . For heterologous expression in mesophilic hosts such as E. coli, temperature-adjusted protocols are necessary, typically using inducible expression systems with lower temperatures (15-30°C) to ensure proper folding of this hyperthermophilic protein. Expression vectors should include thermostable selection markers and consideration for codon optimization based on the expression host.

What is the recommended procedure for purifying recombinant P. islandicum uppP?

Purification of recombinant P. islandicum uppP typically follows these steps:

  • Cell lysis under native conditions, using detergent-based buffers suitable for membrane proteins

  • Initial purification through affinity chromatography using an appropriate tag system determined during production

  • Further purification through size exclusion or ion exchange chromatography

  • Storage in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term preservation

For working aliquots, storage at 4°C is recommended for up to one week. Repeated freeze-thaw cycles should be avoided to maintain protein integrity and activity.

How should researchers evaluate the enzymatic activity of purified P. islandicum uppP?

Enzymatic activity of purified P. islandicum uppP can be evaluated through:

  • Phosphatase assays using synthetic undecaprenyl pyrophosphate substrates

  • Monitoring the release of inorganic phosphate using colorimetric methods such as malachite green assay

  • Testing at various temperatures (preferably 85-95°C) to determine thermostability and optimal reaction conditions

  • pH optimization studies (based on search results, testing across pH 5-9 would be appropriate)

  • Bacitracin susceptibility assays in heterologous expression systems, as UppP activity has been correlated with bacitracin resistance in other bacterial species

All assays should include appropriate controls and be performed under anaerobic conditions when possible to mimic the native environment of P. islandicum.

What are the optimal growth conditions for P. islandicum cultures when studying uppP function?

P. islandicum should be cultured under the following conditions for optimal growth when studying uppP function:

  • Temperature: 95°C (±0.1°C)

  • Atmosphere: Strictly anaerobic conditions (media flushed with argon at approximately 30 ml/min)

  • Media composition:

    • 10 g/L tryptone

    • 2 g/L yeast extract

    • 1X DSM390 salts

    • 1X DSM88 trace elements

    • 20 mM Na₂S₂O₃

    • 0.5 mM cysteine-HCl as a reducing agent

  • pH: 5.7 (±0.1) for optimal growth with Fe(III) citrate, thiosulfate, and sulfur media

  • Agitation: 120-150 rpm if using a fermentor setup

Growth should be monitored by cell counting using a Petroff-Hausser counting chamber and phase-contrast light microscopy, with cultures typically harvested at late logarithmic growth phase (approximately 10⁸ cells/ml) .

How does pH affect the growth of P. islandicum, and what implications does this have for uppP function?

The pH significantly impacts P. islandicum growth depending on the terminal electron acceptor used:

Terminal Electron AcceptorpH Range for GrowthOptimal pHNotes
Sulfur (S⁰)5-75-6Requires highly reduced conditions (<-420 mV)
Thiosulfate6-86-7Requires highly reduced conditions (<-420 mV)
Fe(III) citrate6-97-8More oxidized conditions (>-210 mV)
Fe(III) oxide hydroxide6.2-97-8Turns to clay below pH 6.2, more oxidized conditions (>-210 mV)

These pH dependencies may reflect adaptations in membrane proteins like uppP to function optimally under specific environmental conditions . For experimental designs targeting uppP function, researchers should consider these pH optima, especially when comparing uppP activity across different growth conditions.

How might the uppP function in P. islandicum relate to its unique iron reduction mechanisms?

The function of uppP in P. islandicum may indirectly relate to its iron reduction mechanisms through cell wall integrity and membrane organization. P. islandicum requires direct contact with insoluble iron oxide for growth and does not produce extracellular compounds to facilitate iron reduction, unlike some other microorganisms . This direct contact mechanism suggests a specialized cell surface interface where membrane proteins, potentially including uppP, might play supportive roles.

The iron reduction mechanism in P. islandicum appears to be completely independent of c-type cytochromes, which differs from many other iron-reducing microorganisms . This unique characteristic raises questions about alternative electron transfer mechanisms and the potential role of membrane phospholipid maintenance (involving uppP) in supporting these specialized pathways. Research investigating the membrane proteome during growth on different electron acceptors could reveal correlations between uppP expression levels and iron reduction capacity.

What techniques are recommended for investigating the role of uppP in hyperthermophilic stress response?

To investigate the role of uppP in hyperthermophilic stress response, researchers should consider:

  • Gene Knockout/Knockdown Studies:

    • Generate uppP deletion mutants in P. islandicum

    • Evaluate growth rates under various stressors (temperature extremes, pH fluctuations, oxidative stress)

    • Compare membrane integrity between wild-type and mutant strains

  • Expression Analysis:

    • Utilize gene fusions (uppP-reporter constructs) similar to the uppP-lacZ approach used in E. faecalis studies

    • Implement 5'-RACE to identify transcriptional start sites and potential regulatory elements

    • Perform qRT-PCR to quantify uppP expression under different stress conditions

  • Comparative Genomics:

    • Analyze uppP conservation across Pyrobaculum species with different growth optima

    • Examine genetic context of uppP within the CRISPR-associated genomic regions of Pyrobaculum species

    • Identify potential co-regulated genes through transcriptomic analyses

  • Biochemical Characterization:

    • Test enzyme kinetics at varying temperatures and pH values

    • Evaluate structural stability using circular dichroism spectroscopy

    • Perform site-directed mutagenesis to identify residues critical for thermostability

How can researchers distinguish between general membrane effects and specific enzymatic activities when studying P. islandicum uppP?

Distinguishing between general membrane effects and specific enzymatic activities requires:

  • Complementation Studies:

    • Express P. islandicum uppP in model organisms (E. coli, B. subtilis) with uppP deletions

    • Measure restoration of specific phenotypes related to cell wall synthesis

    • Compare with catalytically inactive mutants (site-directed mutagenesis of active site)

  • Membrane Fractionation:

    • Separate inner and outer membrane fractions

    • Localize uppP activity precisely within membrane compartments

    • Assess membrane fluidity and composition in uppP mutants versus wild-type

  • Substrate Specificity Analysis:

    • Test activity against various pyrophosphate substrates

    • Determine kinetic parameters (Km, Vmax) at different temperatures

    • Compare with structurally similar phosphatases to identify unique catalytic properties

  • In situ Visualization:

    • Develop fluorescently-tagged uppP variants that retain function

    • Monitor localization during different growth phases and stress conditions

    • Correlate localization patterns with cellular processes

How does P. islandicum uppP compare to homologous proteins in other Pyrobaculum species?

The genomic context of uppP may also vary between Pyrobaculum species, potentially reflecting adaptations to their specific ecological niches. The gene appears to be part of the core genome across the genus, although specific regulatory elements might differ. Comparative analysis of these homologs could provide insights into the evolution of membrane-associated processes in hyperthermophilic archaea.

What experimental approaches would best elucidate the evolutionary relationship between bacterial UppPs and archaeal homologs like P. islandicum uppP?

To investigate evolutionary relationships between bacterial UppPs and P. islandicum uppP, researchers should consider:

  • Phylogenetic Analysis:

    • Construct comprehensive phylogenetic trees using UppP sequences from diverse bacterial and archaeal species

    • Employ both maximum likelihood and Bayesian inference methods

    • Include outgroups from distantly related phosphatase families

  • Structural Comparison:

    • Determine crystal structures of archaeal and bacterial UppPs

    • Compare active site architecture and substrate-binding pockets

    • Identify conserved motifs and archaeal-specific structural adaptations

  • Functional Complementation:

    • Express P. islandicum uppP in bacterial uppP mutants (e.g., E. coli bacA mutants)

    • Test if archaeal uppP can rescue bacterial phenotypes

    • Determine if complementation requires specific adaptations

  • Selective Pressure Analysis:

    • Calculate Ka/Ks ratios across uppP sequences

    • Identify residues under positive or purifying selection

    • Correlate selection patterns with functional domains

  • Horizontal Gene Transfer Assessment:

    • Analyze GC content, codon usage bias, and genome context

    • Identify potential genomic islands containing uppP

    • Evaluate the hypothesis of ancient versus recent gene transfer events

What are common challenges in working with recombinant P. islandicum uppP and how can they be addressed?

Common challenges and solutions when working with recombinant P. islandicum uppP include:

Challenge 1: Low expression yields

  • Solution: Optimize codon usage for expression host

  • Solution: Test multiple expression systems (pET, pBAD, etc.)

  • Solution: Evaluate expression at different temperatures and induction conditions

  • Solution: Consider fusion partners that enhance solubility (MBP, SUMO, etc.)

Challenge 2: Protein aggregation

  • Solution: Include appropriate detergents during extraction and purification

  • Solution: Test various membrane-mimicking environments (nanodiscs, liposomes)

  • Solution: Express truncated versions that retain catalytic activity

  • Solution: Use thermostable fusion partners designed for hyperthermophilic proteins

Challenge 3: Loss of activity during purification

  • Solution: Maintain anaerobic conditions throughout purification

  • Solution: Include stabilizing agents such as glycerol (50%) as indicated in storage recommendations

  • Solution: Minimize exposure to room temperature

  • Solution: Add reducing agents to prevent oxidation of critical residues

Challenge 4: Assay temperature limitations

  • Solution: Develop specialized high-temperature assay equipment

  • Solution: Use thermostable assay components

  • Solution: Perform discontinuous assays with rapid sampling and immediate cooling

How can researchers validate that recombinantly expressed P. islandicum uppP maintains native-like activity?

To validate native-like activity of recombinant P. islandicum uppP, researchers should:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.