Recombinant Pyrococcus abyssi Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Functional Role

Recombinant Pyrococcus abyssi cobS (UniProt ID: Q9V2N1) is a 232-amino-acid enzyme classified as adenosylcobinamide-GDP ribazoletransferase (EC 2.-.-.-). It catalyzes the final steps of cobalamin biosynthesis, transferring a ribazole phosphate group to adenosylcobinamide-GDP . Key features include:

  • Gene: cobS (synonyms: PYRAB00440, PAB2320) .

  • Domain: Contains conserved motifs for cobalamin-5'-phosphate synthase activity .

Recombinant Production and Purification

The enzyme is synthesized in E. coli BL21(DE3) using plasmid vectors (e.g., pET28a+) and purified via:

  • Heat Denaturation: Leverages thermostability of P. abyssi proteins to remove host contaminants .

  • Immobilized Metal Affinity Chromatography (IMAC): His-tag-based purification .

  • Ion-Exchange Chromatography: Further refinement for >90% purity (SDS-PAGE) .

Table 1: Production Parameters

ParameterSpecification
Expression HostEscherichia coli BL21(DE3)
Induction0.5 mM IPTG at mid-log phase
YieldNot quantified in available literature
Purity>90% (SDS-PAGE)

Biochemical Properties

While enzymatic activity data (e.g., KMK_M, VmaxV_{max}) for recombinant cobS remains unpublished, comparative analysis of related P. abyssi enzymes reveals:

  • Thermostability: Expected activity retention at >80°C, consistent with native hyperthermophilic enzymes .

  • pH Optimum: Likely neutral to alkaline (pH 7–9), inferred from homologs .

Research Applications

  • Enzyme Mechanism Studies: Structural analysis of cobalamin biosynthesis .

  • Biotechnological Tool: Potential use in vitamin B12 production or metabolic engineering .

  • Comparative Genomics: Model for studying archaeal cobalamin pathways .

Limitations and Future Directions

Current data gaps include kinetic profiling and in vivo functional validation. Further studies could explore:

  • Substrate specificity using adenosylcobinamide-GDP analogs.

  • Structural resolution via X-ray crystallography or cryo-EM.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; PYRAB00440; PAB2320; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-232
Protein Length
full length protein
Species
Pyrococcus abyssi (strain GE5 / Orsay)
Target Names
cobS
Target Protein Sequence
MRNILPFLTRIPVKGDFEKARNELWAFPLVSLVSSIIPIAILYLRIPLANVLALLSLYFV IGLLHLDGLADWADGIMVKGDRERKIKAMKDLNTGIAGVFAVVVVLFLQVYSLSMLPFYA IYIAELNSKFSMLLGLATKKPLGQGLGAYFMEGMNGRQLAIGVVLYVLLYLPVVIYDPSA LFGVMGLVFAWYVIRLSLENFGGINGDCLGAMAEITRAGTLVILSFSLCFTT
Uniprot No.

Target Background

Function
Cobalamin synthase (cobS) from Pyrococcus abyssi catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by combining adenosylcobinamide-GDP and alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links

KEGG: pab:PAB2320

STRING: 272844.PAB2320

Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Pyrococcus abyssi Cobalamin synthase (cobS) and what is its role in vitamin B12 metabolism?

Pyrococcus abyssi Cobalamin synthase (cobS) is a full-length protein (232 amino acids) involved in the biosynthesis of vitamin B12 (cobalamin). The protein functions as an adenosylcobinamide-GDP ribazoletransferase and is also known as cobalamin-5'-phosphate synthase . It catalyzes one of the final steps in the complex pathway of cobalamin synthesis, which is essential for the production of this vital cofactor. In the context of vitamin B12 metabolism, cobalamin serves as a cofactor for critical enzymes including methionine synthase and methylmalonyl CoA mutase . While higher eukaryotes like humans require dietary intake of vitamin B12, microorganisms like Pyrococcus abyssi have evolved the machinery to synthesize this complex molecule independently, with cobS playing a crucial role in this pathway.

What are the optimal conditions for recombinant expression of P. abyssi cobS in E. coli systems?

For optimal recombinant expression of P. abyssi cobS in E. coli systems, researchers should consider several key factors that can enhance protein yield and solubility. The expression of hyperthermophilic proteins in mesophilic hosts often presents challenges due to differences in codon usage, protein folding machinery, and cellular environments. Successful expression strategies typically include using E. coli strains with enhanced codon usage (such as Rosetta or BL21-CodonPlus strains) that contain additional tRNAs for rare codons commonly found in archaeal genes .

Expression vectors containing T7 promoter systems under the control of IPTG-inducible lac operators have proven effective for archaeal protein expression . Lower induction temperatures (16-25°C) can significantly improve proper folding and solubility of recombinant archaeal proteins compared to standard induction at 37°C. Additionally, the incorporation of an N-terminal His-tag has been successfully employed for P. abyssi cobS expression, facilitating subsequent purification steps without compromising protein functionality .

What purification strategies yield the highest purity and activity for recombinant cobS protein?

High-purity recombinant P. abyssi cobS protein can be obtained through a multi-step purification process that exploits the His-tag and the thermostable nature of this archaeal protein. The recommended purification strategy begins with immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins, which have high affinity for the His-tagged protein . For enhanced purity, a heat treatment step (70-80°C for 15-20 minutes) can be incorporated before or after the initial IMAC purification, exploiting the thermostability of P. abyssi proteins to eliminate many E. coli contaminants.

After initial purification, the protein can be further purified using ion exchange chromatography based on its predicted isoelectric point, followed by size exclusion chromatography for final polishing. The purified protein should be stored in Tris/PBS-based buffer containing 6% trehalose at pH 8.0 to maintain stability . For long-term storage, aliquoting with 30-50% glycerol and storing at -20°C/-80°C is recommended to preserve activity and prevent repeated freeze-thaw cycles which can compromise protein integrity.

How can researchers assess the enzymatic activity of recombinant P. abyssi cobS in vitro?

Assessment of recombinant P. abyssi cobS enzymatic activity requires specialized assays that monitor its adenosylcobinamide-GDP ribazoletransferase function. The most direct approach involves measuring the conversion of adenosylcobinamide-GDP to adenosylcobalamin-5'-phosphate using HPLC or LC-MS analysis. This assay requires adenosylcobinamide-GDP as substrate, which can be synthesized enzymatically or obtained commercially.

A more accessible method involves coupling cobS activity to downstream or upstream enzymes in the cobalamin synthesis pathway and measuring either substrate consumption or product formation spectrophotometrically. Researchers should conduct these assays at elevated temperatures (70-90°C) to reflect the hyperthermophilic nature of P. abyssi, using appropriate buffers that maintain stability at high temperatures. Control experiments should include heat-inactivated enzyme and reactions without the key substrates to validate specific enzymatic activity.

For kinetic analysis, researchers can vary substrate concentrations and measure initial reaction velocities to determine Km and Vmax values, providing insights into the enzyme's catalytic efficiency and substrate affinity under various conditions.

What approaches can be used to investigate the thermostability mechanisms of P. abyssi cobS?

The thermostability of P. abyssi cobS, derived from an organism that thrives at temperatures around 90°C, makes it an excellent model for studying protein adaptation to extreme conditions. Several complementary approaches can be employed to investigate its thermostability mechanisms.

Differential scanning calorimetry (DSC) and circular dichroism (CD) spectroscopy can be used to determine melting temperatures (Tm) and monitor conformational changes under various temperature conditions. Comparing wild-type cobS with site-directed mutants targeting potential stabilizing features (such as salt bridges, disulfide bonds, or hydrophobic cores) can identify key residues contributing to thermostability.

Structural analysis using X-ray crystallography or cryo-electron microscopy would provide atomic-level insights into the protein's thermostable architecture. This can be complemented with molecular dynamics simulations at elevated temperatures to observe conformational flexibility and identify stabilizing interactions. Additionally, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can reveal regions of different structural stability within the protein.

Comparative analysis with mesophilic homologs can highlight evolutionary adaptations specific to thermostability, particularly by examining amino acid composition biases and specialized structural features like compact hydrophobic cores or surface charge distributions.

How does P. abyssi cobS compare with cobalamin synthases from other extremophiles and mesophiles?

Comparative analysis of P. abyssi cobS with homologs from other extremophiles and mesophiles reveals important evolutionary adaptations related to environmental niche specialization. Hyperthermophilic cobalamin synthases like that from P. abyssi typically exhibit several distinguishing features compared to their mesophilic counterparts.

At the sequence level, P. abyssi cobS shows a higher proportion of charged amino acids (particularly glutamate and lysine) that can form stabilizing salt bridges, as well as increased hydrophobic amino acids in core regions . These compositional biases contribute to the protein's ability to maintain structural integrity at extreme temperatures. The enzyme likely has a more rigid structure at room temperature compared to mesophilic homologs, but exhibits similar flexibility at its physiological temperature of ~90°C.

Functional comparisons reveal that while the catalytic mechanism is largely conserved across species, the optimal temperature and pH profiles differ significantly. P. abyssi cobS demonstrates highest activity at temperatures that would denature mesophilic versions. Additionally, archaeal cobalamin synthases may exhibit different substrate specificity or cofactor requirements compared to bacterial homologs, reflecting the evolutionary divergence of these domains.

What are common challenges in obtaining active recombinant P. abyssi cobS and how can they be addressed?

Researchers working with recombinant P. abyssi cobS often encounter several challenges that can be systematically addressed through optimization strategies. One frequent issue is the formation of inclusion bodies during expression in E. coli, resulting in insoluble protein. This can be mitigated by lowering the induction temperature (16-20°C), reducing IPTG concentration, or co-expressing molecular chaperones that assist in proper protein folding .

Another common challenge is the potential misfolding of the protein due to the significant temperature difference between E. coli's growth conditions and P. abyssi's native environment. Expression in cold-adapted E. coli strains or using a heat-shock step during cell lysis can help promote proper folding. In cases where the protein remains insoluble, solubilization from inclusion bodies followed by refolding under controlled redox conditions while gradually increasing temperature may recover active protein.

The presence of multiple transmembrane domains in cobS can also pose purification challenges. Using mild detergents (such as n-dodecyl β-D-maltoside or CHAPS) during extraction and purification can help maintain the native conformation of membrane-associated regions. Finally, ensuring proper reconstitution after lyophilization is crucial for maintaining activity; this can be achieved by following the recommended buffer conditions (Tris/PBS-based buffer with 6% trehalose at pH 8.0) and avoiding repeated freeze-thaw cycles .

How can researchers optimize storage conditions to maintain long-term stability and activity of purified cobS?

Maintaining long-term stability and activity of purified P. abyssi cobS requires careful attention to storage conditions that preserve its native conformation. The recommended approach involves storing the protein in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain protein structure during freeze-thaw cycles . For long-term storage, the addition of 30-50% glycerol and storage at -80°C in small aliquots minimizes damage from repeated freeze-thaw events.

Studies on other hyperthermophilic proteins suggest that storing cobS at 4°C for short periods (up to one week) may be preferable to freezing and thawing for experiments requiring repeated use . The addition of reducing agents such as dithiothreitol (DTT) or β-mercaptoethanol at low concentrations can prevent oxidation of sensitive cysteine residues, further enhancing stability.

For researchers working with lyophilized protein, proper reconstitution is crucial. The recommended procedure involves brief centrifugation of the vial before opening, followed by reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL . This reconstituted protein should then be supplemented with glycerol to a final concentration of 30-50% before aliquoting for storage at -20°C/-80°C.

What potential applications exist for thermostable cobS in biotechnological processes?

The extreme thermostability of P. abyssi cobS opens avenues for various biotechnological applications, particularly in processes that benefit from high-temperature conditions. One promising application is its potential use in the enzymatic synthesis of vitamin B12 and its derivatives, which typically involves multiple complex chemical steps. Thermostable enzymes like cobS could enable these reactions to occur at elevated temperatures, potentially increasing reaction rates and reducing microbial contamination risks.

In biocatalysis, the thermostability of cobS could be exploited for use in cascade reactions with other thermostable enzymes, creating multi-enzyme systems that can operate efficiently at high temperatures. This approach is particularly valuable for industrial processes where thermal stability translates to extended catalyst lifetimes and reduced enzyme replacement costs.

Additionally, the structural features that confer thermostability to cobS could inform protein engineering strategies for enhancing the stability of mesophilic enzymes. By identifying and transferring key stabilizing elements from cobS to less stable proteins, researchers might develop improved biocatalysts for various industrial applications. The knowledge gained from studying cobS thermostability could also contribute to the development of novel protein-based materials with enhanced thermal resistance properties.

How can structural studies of P. abyssi cobS contribute to understanding archaeal adaptation to extreme environments?

Structural studies of P. abyssi cobS provide valuable insights into the molecular adaptations enabling archaea to thrive in extreme environments. X-ray crystallography, cryo-electron microscopy, or nuclear magnetic resonance spectroscopy of cobS can reveal specific structural features that contribute to its remarkable thermostability, such as increased numbers of salt bridges, hydrophobic interactions, and disulfide bonds compared to mesophilic homologs .

These structural investigations can clarify how P. abyssi, living at deep-sea hydrothermal vents with temperatures approaching 100°C, has evolved proteins capable of maintaining functional three-dimensional configurations under conditions that would rapidly denature most proteins. The comparison of cobS structures at different temperatures can further elucidate the dynamic properties that allow these proteins to remain flexible enough for catalysis while retaining structural integrity.

Beyond thermostability, structural studies of cobS may reveal adaptations to other extreme conditions present in the native environment of P. abyssi, such as high pressure, fluctuating pH, or high salt concentrations. These findings would contribute to the broader understanding of life's adaptability to extreme environments, with potential implications for astrobiology and the search for life in extreme environments beyond Earth.

What are emerging research directions involving P. abyssi cobS in understanding cobalamin metabolism?

Emerging research on P. abyssi cobS is expanding our understanding of cobalamin metabolism in several innovative directions. One significant trend involves comparative genomic and proteomic analyses of cobalamin biosynthesis pathways across archaea, bacteria, and eukaryotes to understand the evolutionary history and functional diversification of this essential cofactor production system . P. abyssi cobS serves as an important archaeal representative in these studies, highlighting domain-specific adaptations in vitamin B12 synthesis.

Another promising research direction explores the interaction networks of cobS with other enzymes in the cobalamin biosynthesis pathway. Similar to the findings for P. abyssi NucS protein, which forms a stable complex with proliferating cell nuclear antigen (PCNA) , investigations into potential protein-protein interactions of cobS could reveal coordinated regulation mechanisms in cobalamin production under extreme conditions.

The role of cobS in adaptation to environmental stresses beyond high temperature is also gaining attention. Research examining how cobalamin synthesis responds to various stressors could provide insights into metabolic plasticity in extremophiles. Additionally, functional studies comparing archaeal cobS enzymes from different extremophiles (thermophiles, halophiles, acidophiles) are beginning to reveal how environmental pressures shape the evolution of these essential metabolic enzymes.

How might comparative studies between archaeal and bacterial cobalamin synthases inform evolutionary biology?

Comparative studies between archaeal cobalamin synthases like P. abyssi cobS and their bacterial counterparts provide valuable windows into the evolutionary history of essential metabolic pathways. Such studies reveal that while the core function of cobalamin synthesis is conserved across domains of life, the specific adaptations in protein structure and regulation reflect the unique evolutionary trajectories of archaea and bacteria .

Phylogenetic analysis of cobS proteins across diverse species can help reconstruct the evolutionary history of vitamin B12 metabolism, potentially identifying horizontal gene transfer events and illuminating how this complex pathway has evolved. The scattered distribution of vitamin B12 dependency across evolutionary lineages suggests complex gain and loss patterns that comparative cobS studies can help elucidate .

Structural comparisons between archaeal and bacterial cobS enzymes reveal domain-specific adaptations that reflect their divergent environmental niches. For archaeal enzymes from hyperthermophiles like P. abyssi, these adaptations include specific amino acid compositions and structural features that enable function at extreme temperatures. Analyzing these differences provides insights into the molecular basis of protein adaptation and the forces driving protein evolution across the domains of life.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.