WtpB is the permease subunit of the WtpABC transporter system, which includes:
WtpA: A periplasmic binding protein that selectively binds molybdate/tungstate with high affinity.
WtpB: A transmembrane permease facilitating oxyanion translocation across the cytoplasmic membrane.
WtpC: An ATPase providing energy for transport via ATP hydrolysis.
This system is distinct from bacterial ModABC (molybdate-specific) and TupABC (tungstate-specific) transporters due to its dual specificity and archaeal origin .
Gene Name: wtpB (locus tag: PYRAB01530/PAB0102 in P. abyssi) .
UniProt ID: Q9V2C1.
Amino Acid Sequence:
MGGRDYTLYLFAALGSFLIVYIALPIIVIFTKQALDFRMLVKTIHDPLVIEALRNSLLTATATALISLLFGVPLGYVLARKDFRGKSLVQAIIDVPIVIPHSVVGIMLLVTFSNAILDSYKGIIAAMLFVSAPFAINSARDGFLAVDEKLEHVARTLGASKLRTFFSISLPIALPSIASGAIMAWARGISEVGAILIVAYYPKTAQVLVMEYFNNYGLRASRPISVILMGISLGIFVVLRWLIGKAKS .
WtpB homologs are predominantly found in archaea (Pyrococcus, Thermococcus, Methanosarcina) and rare bacteria (Desulfotalea psychrophila). This contrasts with bacterial ModA/TupA systems, highlighting evolutionary divergence .
| Organism | Homolog Presence | Anaerobic Lifestyle |
|---|---|---|
| Pyrococcus abyssi | + | Yes |
| Methanosarcina mazei | + | Yes |
| Escherichia coli | − | Facultative |
| Desulfotalea psychrophila | + | Yes |
| Data adapted from genomic analyses . |
Host: Recombinant WtpB is expressed in Escherichia coli with an N-terminal His-tag for affinity purification .
Yield: ~5 mg/L culture (similar to WtpA yields in related systems) .
Stability: Retains solubility after heat treatment (60°C for 30 min), consistent with the thermostability of Pyrococcus proteins .
Substrate Specificity: The WtpABC system binds both tungstate () and molybdate () .
Transport Mechanism: WtpB forms a transmembrane channel, coupling WtpA-substrate binding to ATP-driven translocation via WtpC .
Enzyme Production: Essential for producing tungsten-containing enzymes (e.g., aldehyde oxidoreductases) in recombinant systems .
Metal Recovery: Potential use in bioengineering for selective recovery of molybdenum/tungsten from industrial waste .
The WtpABC system provides insights into how archaea evolved distinct metal uptake strategies compared to bacteria, particularly in extremophiles lacking ModA/TupA homologs .
KEGG: pab:PAB0102
STRING: 272844.PAB0102
The WtpB protein likely functions as a transmembrane component of the ABC transporter complex that works in conjunction with the substrate-binding protein (similar to WtpA in P. furiosus) and an ATP-binding protein. In related systems, such as that found in P. furiosus, the operon contains three genes (PF0080, PF0081, and PF0082) that code for components of a tungstate-selective ABC transporter. The substrate-binding protein (WtpA) has been shown to bind tungstate with extremely high affinity (Kᴅ of 17 ± 7 pM) and molybdate with slightly lower affinity . By analogy, the WtpB permease component would form a channel across the cell membrane through which the metal ions are transported after initial binding by the substrate-binding protein.
Based on successful approaches with related transport proteins, the following protocol is recommended for recombinant WtpB expression:
Gene cloning strategy: Remove the native leader sequence if present, as this approach has been successful with related proteins like WtpA from P. furiosus. The native leader sequence in related proteins has caused association with the cytoplasmic membrane when expressed in E. coli .
Expression vector selection: Consider using a vector system like pASK-IBA2 which contains an N-terminal E. coli leader sequence (such as the OmpA leader peptide) that facilitates protein export across the cytoplasmic membrane .
Affinity tag addition: Incorporate a C-terminal affinity tag such as Strep-tag for streamlined purification .
Expression host: Use E. coli BL21(DE3) as the recombinant expression host, which has been successful for related archaeal proteins .
Induction conditions: Optimize induction temperature (typically 16-30°C) and inducer concentration to maximize soluble protein yield.
A multi-step purification approach is typically required:
Initial capture: Utilize affinity chromatography based on the incorporated tag (e.g., Strep-Tactin affinity chromatography for Strep-tagged proteins) .
Secondary purification: Apply ion exchange chromatography as a secondary purification step to remove remaining contaminants.
Final polishing: Size exclusion chromatography to achieve high purity and remove aggregates.
Buffer optimization: Experimentally determine the optimal buffer conditions that maintain protein stability and functionality.
Yield assessment: Expect yields similar to related proteins; for context, WtpA from P. furiosus yielded approximately 5 mg of purified protein per liter of induced E. coli culture .
Reconstitution in liposomes: Reconstitute purified WtpB into liposomes and measure transport of radioactively labeled tungstate or molybdate.
Isothermal titration calorimetry (ITC) with detergent-solubilized protein: While challenging, this approach has been used for other membrane proteins to measure ligand binding. For context, ITC with the soluble WtpA protein from P. furiosus demonstrated extremely high affinity for tungstate (Kᴅ of 17 ± 7 pM) and molybdate (Kᴅ in picomolar range) .
Surface plasmon resonance (SPR): Immobilize the detergent-solubilized WtpB on a sensor chip and measure binding of different metal ions.
Transport assays in whole cells: Express WtpB in a heterologous system lacking endogenous tungstate/molybdate transporters and measure uptake rates of different metals.
While direct structural data on WtpB is not available in the search results, several approaches can address this question:
Comparative sequence analysis: Analyze the WtpB sequence in comparison with other characterized permease proteins to identify conserved motifs potentially involved in substrate recognition and transport.
Homology modeling: Utilize structures of related ABC transporter permease proteins to generate structural models of WtpB.
Site-directed mutagenesis: Mutate conserved residues predicted to be involved in substrate transport and measure the impact on transport activity.
Cryo-electron microscopy: Apply methods similar to those used for the P. abyssi PolD-Rpa2 complex to determine the structure of the entire tungstate/molybdate ABC transporter complex, including WtpB.
Cross-linking studies: Identify regions of WtpB that interact with other components of the transport system, such as the substrate-binding protein and the ATP-binding protein.
The functional ABC transporter complex requires specific interactions between its components. Based on analogous systems, the following approaches can be employed to study these interactions:
Co-purification experiments: Express and purify the entire operon to isolate the intact complex.
Bacterial two-hybrid assays: Map specific regions involved in protein-protein interactions.
Surface plasmon resonance: Quantify binding affinities between purified components.
Cross-linking followed by mass spectrometry: Identify interaction interfaces within the assembled complex.
Microscale thermophoresis: Measure affinities between components in solution.
These methods can clarify how WtpB interacts with the substrate-binding protein (similar to WtpA) and the ATP-binding component to form a functional transport complex.
The stoichiometry of ABC transporters can be determined through:
Analytical ultracentrifugation of the purified complex
Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)
Mass photometry for single-molecule analysis
Native mass spectrometry
Cryo-electron microscopy of the assembled complex
Several complementary approaches can be used:
Reconstituted proteoliposome assays: Reconstitute purified WtpB along with the ATP-binding component into liposomes and measure ATP-dependent transport of radiolabeled tungstate or molybdate.
Fluorescence-based assays: Utilize fluorescent metal ion indicators inside proteoliposomes to measure real-time transport.
Counterflow assays: Preload proteoliposomes with unlabeled substrate and measure the uptake of radiolabeled substrate in the absence of ATP to assess the transport channel functionality.
ATP hydrolysis assays: Measure ATP hydrolysis rates in the presence of WtpB and different concentrations of substrate to establish kinetic parameters.
Patch-clamp techniques: Apply electrophysiological methods to measure ion conductance through WtpB channels when reconstituted in planar lipid bilayers.
To determine transport kinetics:
Time-course measurements: Perform transport assays with varying substrate concentrations and measure uptake at multiple time points.
Michaelis-Menten analysis: Calculate Km and Vmax values for different substrates.
Stopped-flow techniques: Measure rapid kinetics of transport processes with millisecond resolution.
Competition assays: Use varying concentrations of competing ions to determine relative affinities and transport preferences.
Influence of physiological factors: Assess how pH, temperature, and ionic strength affect transport kinetics, especially considering the thermophilic nature of P. abyssi.
This data should be presented as kinetic curves and transformed into standard kinetic parameters (Km, Vmax, kcat) to enable comparison with other transport systems.
Evolutionary analysis of WtpB can reveal important functional insights:
Sequence alignment and phylogenetic analysis: Compare WtpB sequences across species to identify conserved regions and evolutionary relationships.
Functional conservation testing: Express homologous proteins from different species and compare their transport capabilities and substrate specificities.
Domain architecture analysis: Identify conserved domains and motifs across species.
Comparative structural modeling: Generate structural models of WtpB from different species to identify structural conservation and divergence.
For context, the homologous system in P. furiosus (the WtpA protein) has been shown to be part of a new ABC transporter system selective for tungstate and molybdate, with very low sequence similarity to previously characterized transport proteins ModA for molybdate and TupA for tungstate .
This question can be addressed through:
Genome mining: Search for WtpB homologs across all domains of life.
Functional complementation studies: Test if WtpB can rescue transport-deficient mutants in bacteria or eukaryotes.
Comparative biochemical characterization: Purify and characterize homologous proteins from diverse organisms.
Available data suggests that tungstate transport systems show diversity across life domains. The WtpA system, for example, has been identified in numerous archaea and some bacteria, clarifying the mechanism of tungstate and molybdate transport in organisms that lack the known uptake systems associated with ModA and TupA proteins .
Understanding the regulation of transport systems is crucial for interpreting their physiological role:
Quantitative PCR: Measure WtpB transcript levels under varying metal concentrations.
Reporter gene assays: Fuse the WtpB promoter to reporter genes to study regulatory mechanisms.
RNA-seq analysis: Perform transcriptome analysis under different metal availability conditions.
Chromatin immunoprecipitation: Identify transcription factors that regulate WtpB expression.
Microarray experiments: Similar to what has been done for WtpA in P. furiosus, where mRNA fragments carrying the gene have been detected, indicating in vivo expression .
This physiological question can be addressed through:
Gene knockout or CRISPR-based genome editing: Generate WtpB-deficient strains.
Activity assays of tungsten-dependent enzymes: Measure the activity of enzymes such as aldehyde ferredoxin oxidoreductase and formaldehyde ferredoxin oxidoreductase.
Metabolic profiling: Compare metabolite profiles between wild-type and WtpB-deficient strains.
Growth assays: Compare growth rates and yields under varying tungstate/molybdate concentrations.
Protein expression profiling: Use proteomics to identify changes in the tungsten-dependent proteome.
Expressing archaeal proteins in bacterial hosts presents several challenges:
Proteins from hyperthermophilic archaea like P. abyssi (optimal growth temperature ~96°C) require special handling:
Buffer optimization: Include osmolytes such as glycerol, betaine, or sorbitol to enhance thermal stability.
Reducing agents: Maintain appropriate reducing conditions to prevent oxidation of cysteine residues.
Metal ion inclusion: Add trace amounts of tungstate or molybdate to stabilize the native conformation.
Detergent screening: For membrane proteins like WtpB, test multiple detergents to identify those that best preserve native structure and function.
Storage conditions: Determine optimal conditions for short-term and long-term storage (e.g., flash-freezing vs. storage at 4°C).
Thermal stability assays: Employ differential scanning fluorimetry to quantitatively assess the impact of different buffer conditions on protein stability.
Understanding WtpB structure-function relationships could enable:
Protein engineering: Design modified transporters with altered metal selectivity or improved efficiency.
Bioremediation applications: Develop microbial systems for selective removal of metals from contaminated environments.
Biosensor development: Create biosensors for specific detection of tungstate or molybdate in environmental or biological samples.
Synthetic biology approaches: Incorporate engineered transport systems into synthetic cellular factories for specialized applications.
Structural basis for inhibitor design: Develop specific inhibitors of metal transport for potential antimicrobial applications against pathogenic archaea or bacteria.
Recent technological advances applicable to WtpB research include:
Cryo-electron microscopy: Techniques like those used for the P. abyssi PolD-Rpa2 complex at 2.94 Å resolution could be applied to the WtpB transport complex.
Integrative structural biology approaches: Combining NMR, X-ray crystallography, and cryo-EM as was done for studying Replication Protein A interactions .
Nanodiscs and lipid cubic phase crystallization: Improved methods for membrane protein stabilization during structural studies.
Single-molecule FRET: Monitoring conformational changes during the transport cycle.
In-cell NMR: Structural and functional characterization within a cellular environment.
AlphaFold and other AI-based structure prediction: Computational approaches to predict WtpB structure and interactions.
Critical areas for future research include:
Regulatory networks: How metal ion sensing is integrated with transporter expression.
Transport mechanism: Atomic-level understanding of the ion translocation pathway.
Evolutionary adaptation: How these systems adapted to extreme environments such as high temperatures.
Interaction with metallochaperones: Understanding how transported metals are distributed to target enzymes.
Physiological integration: How metal transport systems coordinate with cellular metabolism.