Recombinant Pyrococcus abyssi Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Overview of HtpX Protease in Pyrococcus Species

HtpX is a membrane-associated metalloprotease belonging to the M48 peptidase family, implicated in protein quality control during heat shock and oxidative stress in hyperthermophilic archaea . In P. abyssi, the gene encoding HtpX (locus tag PAB0208) shares homology with P. furiosus PF1790 (phr) and other archaeal HtpX proteases . Recombinant production enables biochemical characterization of this enzyme, which is challenging to study in native extremophilic conditions.

Table 1: Comparative Features of HtpX Homologs in Archaea

SpeciesLocus TagLength (aa)Induced by Heat ShockPredicted Localization
P. abyssiPAB0208~290*Yes Membrane
P. furiosusPF1790289Yes (12-fold) Membrane
A. fulgidusAF02353052-fold induction Membrane

*Inferred from homologous sequences .

Functional Role and Mechanism

HtpX proteases are critical for degrading misfolded proteins under stress conditions:

  • Heat shock response: Transcriptional upregulation during thermal stress (e.g., 2-fold induction in A. fulgidus) .

  • Substrate specificity: Preferentially cleaves hydrophobic residues in unstructured regions, analogous to bacterial HtpX .

  • Regulation: In P. furiosus, HtpX expression is controlled by the heat shock regulator phr (PF1790), which binds promoter regions of stress-responsive genes .

Recombinant Production and Purification

While no direct reports on P. abyssi HtpX production exist, methods for homologous archaeal proteases include:

  • Cloning: Gene insertion into E. coli vectors (e.g., pET28a+) with N-terminal His tags for affinity purification .

  • Expression: Induction with 0.5–1 mM IPTG at 37°C .

  • Purification: Heat denaturation (≥80°C) to eliminate host proteins, followed by nickel-affinity or ion-exchange chromatography .

Table 2: Example Protocol for Recombinant Archaeal Protease Production

StepConditionsYield/Purity
CloningpET28a+ in BL21(DE3) E. coli Confirmed by sequencing
Induction0.5 mM IPTG, 16–20 hrs at 37°C ~10–20 mg/L culture
Heat Treatment30 min at 80°C >50% purity
ChromatographyNi-NTA or DEAE-column >90% purity

Research Findings and Applications

Key discoveries from related studies:

  • Stress adaptation: P. furiosus HtpX is upregulated 12-fold during heat shock, suggesting a central role in thermal resilience .

  • Biotechnological potential: Thermostable proteases like HtpX are explored for industrial protein processing and enzyme engineering .

  • Structural insights: Molecular docking studies predict active-site residues (e.g., His112, Gln142) critical for catalytic activity in homologs .

Challenges and Future Directions

  • Functional validation: P. abyssi HtpX requires empirical characterization of kinetics and substrate specificity.

  • Structural resolution: No crystal structures exist for archaeal HtpX; cryo-EM studies could elucidate mechanism.

  • Industrial optimization: Enhancing expression yields in E. coli via codon optimization or fusion tags .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs unless otherwise specified. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; PYRAB11430; PAB0758; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Pyrococcus abyssi (strain GE5 / Orsay)
Target Names
htpX
Target Protein Sequence
MGLGLWIRTGVLMAFLTALLVGIGYLIGGRGGMIIAFTIALFMNLISYWFSDSIVLSWYN ARIVSEEEAPELHYIVEKLARQAGIPKPKVAIVPTMVPNAFATGRGPGNAVVAVTEGLLH LLNRDELEGVIAHEISHIKNRDTLIQTLAAVLAGAIMILVDFARWSLWFGAYDDERDSGS VIGLILAIVLAPLAATLIQLAISRSREYLADETGARISGKPHALASALMKIEEAIRYRPL RRGNPATAHMFIVNPFRGVDFAELFSTHPPTEKRIERLRKIALEMGIVF
Uniprot No.

Target Background

Database Links

KEGG: pab:PAB0758

STRING: 272844.PAB0758

Protein Families
Peptidase M48B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Pyrococcus abyssi Protease HtpX homolog and what are its key structural characteristics?

Pyrococcus abyssi Protease HtpX homolog (htpX) is a protease enzyme found in the hyperthermophilic archaeon Pyrococcus abyssi. The protein is characterized by:

  • UniProt accession number: Q9UZK3

  • Full protein length: 289 amino acids

  • Molecular function: Metalloprotease activity (EC 3.4.24.-)

  • Gene names: htpX (primary), PYRAB11430, PAB0758

  • Amino acid sequence beginning with MGLGLWIRTGVLMAFLTALLVGIGYLIGG and ending with KRIERLRKIALEMGIVF

  • Predicted transmembrane regions consistent with a membrane-bound topology

Based on homology to bacterial counterparts, P. abyssi HtpX likely contains zinc-binding motifs characteristic of metalloproteases. The protein's structure suggests it has membrane-spanning domains with a catalytic site accessible from the cytoplasmic side, similar to its homologs in other organisms such as E. coli, where HtpX functions as a membrane-bound metalloprotease with a cytoplasm-exposed active site .

How is htpX regulated in Pyrococcus abyssi and other archaea?

The regulation of htpX in Pyrococcus abyssi and other archaea appears to be primarily linked to stress response pathways, particularly heat shock. Studies in Archaeoglobus fulgidus, another hyperthermophilic archaeon, showed that its HtpX homolog (AF0235) was induced approximately two-fold after 30 minutes of heat shock exposure . This induction pattern indicates that htpX expression increases in response to thermal stress.

In archaea, the heat shock response system often involves specific transcriptional regulators. For example, in Archaeoglobus fulgidus, a heat shock regulator called HSR1 (AF1298) has been identified that regulates the expression of various heat-responsive genes . While direct evidence for HSR1 binding to the htpX promoter in A. fulgidus was not demonstrated in the available studies, the parallel upregulation suggests that htpX likely falls under the control of archaeal heat shock regulatory networks.

By comparison, in bacteria such as E. coli, HtpX is regulated by the CpxA-CpxR two-component system that responds to membrane protein folding stress . Given the evolutionary relationships between these systems, it's reasonable to hypothesize that P. abyssi htpX regulation involves similar stress-responsive transcription factors adapted to the extreme conditions in which this organism thrives.

What biological role does Protease HtpX homolog play in Pyrococcus abyssi?

The Protease HtpX homolog in Pyrococcus abyssi likely plays a crucial role in protein quality control and stress response, particularly under conditions of heat shock or other cellular stresses. Based on studies of homologous proteins in other organisms and the induction pattern observed in Archaeoglobus fulgidus, we can infer several biological functions:

  • Membrane protein quality control: Like its E. coli homolog, P. abyssi HtpX probably participates in the degradation of misfolded or damaged membrane proteins, helping maintain membrane integrity under stress conditions .

  • Heat shock response: The induction of htpX during heat stress in related archaea strongly suggests a role in thermotolerance. This is particularly relevant for P. abyssi, which thrives in hydrothermal vent environments with fluctuating temperatures .

  • Protein homeostasis network component: HtpX likely functions as part of a broader network of proteases and chaperones that collectively maintain protein homeostasis. In Archaeoglobus fulgidus, several ATP-independent proteases are induced alongside HtpX during heat shock, suggesting coordinated action .

  • Potential interaction with the proteasome system: While not directly shown for HtpX, studies in P. abyssi have revealed connections between various quality control proteins and the archaeal proteasome system, suggesting HtpX may work in concert with other degradation machinery .

This multifaceted role makes HtpX an important component of the cellular machinery that allows P. abyssi to survive in extreme environments.

How do the structural and functional properties of P. abyssi HtpX compare to those of its homologs in bacteria and other archaea?

The Pyrococcus abyssi Protease HtpX homolog shares core structural features with its homologs across domains of life, but exhibits important adaptations reflecting its hyperthermophilic lifestyle. A comparative analysis reveals:

Structural similarities:

  • Conservation of the metalloprotease active site motifs, including zinc-binding residues

  • Predicted membrane-spanning topology with multiple transmembrane segments

  • Cytoplasm-exposed catalytic domain architecture

Thermostability adaptations in P. abyssi HtpX (compared to mesophilic homologs):

  • Higher proportion of hydrophobic amino acids in the core structure

  • Increased number of ion pairs and hydrogen bonds

  • Potentially more compact folding of soluble domains

  • Adaptation of membrane-spanning regions to maintain functionality at high temperatures

Functional divergence:

  • While E. coli HtpX is regulated by the CpxA-CpxR system responding to membrane stress, the archaeal homolog appears to be primarily regulated through heat shock response systems

  • The archaeal protease likely demonstrates higher temperature optima and resistance to denaturation

  • May possess distinct substrate specificities adapted to the protein complement of P. abyssi

The integration of HtpX into cellular networks also shows variations, with evidence from related archaea suggesting it participates in a heat-shock response network that has both similarities to and differences from bacterial systems. For instance, the archaeal heat shock regulator HSR1 identified in Archaeoglobus fulgidus represents a distinct regulatory mechanism compared to bacterial systems .

What experimental approaches are most effective for studying the enzymatic activity of recombinant P. abyssi HtpX, considering its thermophilic origin?

Studying the enzymatic activity of recombinant Pyrococcus abyssi HtpX presents unique challenges due to its thermophilic nature and membrane association. The most effective experimental approaches include:

Temperature optimization:

  • Activity assays should be conducted across a temperature range (70-100°C) to determine the optimal temperature for enzymatic function

  • Thermal stability tests using circular dichroism spectroscopy can establish the temperature range where the protein maintains its structural integrity

  • Thermostable buffers such as phosphate or HEPES modified for high-temperature work should be employed

Membrane protein handling:

  • Detergent screening to identify optimal solubilization conditions (e.g., DDM, LDAO, or specialized archaeal lipid-based detergents)

  • Reconstitution into archaeal lipid nanodiscs or liposomes to provide a native-like membrane environment

  • Consideration of directional insertion to ensure the catalytic domain faces the appropriate compartment

Activity assay design:

  • Fluorogenic peptide substrates containing zinc metalloprotease consensus cleavage sites

  • In vitro translation systems coupled with proteolytic detection

  • Mass spectrometry-based approaches to identify cleavage products and map substrate specificity

Specific methodological considerations:

  • Store recombinant protein in stabilizing buffers containing 50% glycerol at -20°C or -80°C

  • Avoid repeated freeze-thaw cycles as noted in product guidelines

  • Working aliquots can be maintained at 4°C for up to one week

These approaches should be complemented with structural studies (X-ray crystallography or cryo-EM) and computational modeling to fully characterize the enzyme's functional properties.

How might the substrate specificity of P. abyssi HtpX differ from its mesophilic counterparts, and what experimental designs could reveal these differences?

The substrate specificity of Pyrococcus abyssi HtpX likely differs from its mesophilic counterparts due to adaptations to extreme temperatures and the unique proteome composition of this hyperthermophilic archaeon. Understanding these differences requires sophisticated experimental designs:

Comparative substrate profiling:

A comprehensive approach would involve parallel testing of P. abyssi HtpX against homologs from mesophilic organisms (e.g., E. coli HtpX) using:

  • Peptide library screening: Employ positional scanning synthetic combinatorial libraries (PS-SCL) with varying amino acid positions to map cleavage site preferences

  • Proteome-derived peptide libraries: Generate peptide collections from both P. abyssi and mesophilic proteomes to identify organism-specific substrates

  • PICS (Proteomic Identification of protease Cleavage Sites) analysis: This method uses proteome-derived peptide libraries and mass spectrometry to determine cleavage sites with high precision

Expected differences and targeted investigations:

Based on the hyperthermophilic nature of P. abyssi, we would anticipate:

  • Preference for substrates that remain structured at high temperatures

  • Potentially higher specificity for membrane proteins with characteristic archaeal features

  • Possible adaptations for recognizing thermally damaged proteins specific to hyperthermophiles

To investigate these hypotheses, researchers could:

  • Create chimeric substrates combining features of archaeal and bacterial membrane proteins

  • Develop thermal damage models by pre-treating potential substrates at varying temperatures

  • Compare cleavage efficiency across temperature ranges (37-95°C) to identify temperature-dependent specificity shifts

Structural basis of specificity:

To understand the molecular basis of substrate recognition:

  • Conduct site-directed mutagenesis of key residues in the active site and substrate-binding pockets

  • Perform molecular dynamics simulations at elevated temperatures to observe substrate interactions

  • Develop co-crystal structures with substrate analogs or inhibitors bound to the active site

These approaches would provide deeper insights into how evolution has shaped the substrate preferences of P. abyssi HtpX to function optimally in extreme environments and potentially reveal novel enzymatic properties with biotechnological applications.

What are the optimal expression and purification conditions for obtaining functional recombinant P. abyssi HtpX?

The expression and purification of functional recombinant Pyrococcus abyssi HtpX requires specialized approaches to accommodate its archaeal origin, membrane-associated nature, and thermostable properties. Based on established protocols for similar proteins, the following optimized methodology is recommended:

Expression system selection:

Expression HostAdvantagesDisadvantagesRecommendation
E. coli BL21(DE3)Well-established, economicalMay improperly fold archaeal membrane proteinsAdd specialized chaperones
E. coli BL21codonplusAddresses codon bias issuesMembrane insertion challenges remainPreferred for initial trials
E. coli Lemo21(DE3)Tunable expression for membrane proteinsLower yields compared to standard strainsGood for optimization phase
Archaeal hosts (e.g., P. furiosus)Native folding environmentTechnical complexity, lower yieldsFor advanced studies if E. coli fails

Optimal expression conditions:

  • Induce at OD600 of 0.8-1.0 with 0.6 mM IPTG

  • Lower induction temperature to 25-30°C to allow proper membrane insertion

  • Extended expression time (12-16 hours) at reduced temperature

  • Consider using specialized media formulations enriched with archaeal-type lipids

Purification strategy:

  • Cell lysis using French press (100 mPa) or sonication in detergent-containing buffer

  • Solubilization with mild detergents (DDM, LDAO) at concentrations above CMC

  • IMAC purification using HisTrap HP columns with step gradient elution

    • Wash with 100 mM imidazole

    • Elute with 400 mM imidazole in multiple fractions

  • Buffer exchange to 20 mM Tris, pH 7.6, 150 mM KCl, 0.5 mM MgCl2, 10% glycerol

  • Consider size exclusion chromatography as a polishing step

Critical quality controls:

  • Verify protein folding using CD spectroscopy at elevated temperatures

  • Confirm zinc incorporation using ICP-MS or specific colorimetric assays

  • Validate proteolytic activity using fluorogenic model substrates

  • Assess thermal stability through differential scanning fluorimetry

When stored properly (-20°C or -80°C in 50% glycerol), the purified protein should maintain activity for several months, though working aliquots should be kept at 4°C for no more than one week to preserve optimal enzymatic function .

What analytical techniques are most appropriate for characterizing the interaction between P. abyssi HtpX and potential protein substrates?

Characterizing interactions between Pyrococcus abyssi HtpX and its potential protein substrates requires techniques that can operate under challenging conditions involving membrane proteins and elevated temperatures. The following analytical approaches are most appropriate:

Biophysical interaction analysis:

  • Isothermal Titration Calorimetry (ITC) with thermostable modifications:

    • Enable measurements at elevated temperatures (up to 80°C)

    • Titrate putative substrates into HtpX solution

    • Quantify binding thermodynamics (ΔH, ΔG, ΔS) and stoichiometry

    • Similar approaches have been successful for studying proteasome interactions in P. abyssi

  • Surface Plasmon Resonance (SPR) with temperature control:

    • Immobilize HtpX on sensor chips compatible with high-temperature measurements

    • Flow substrate proteins at varying concentrations

    • Determine association/dissociation kinetics (kon, koff)

    • Calculate equilibrium dissociation constants (KD)

  • Microscale Thermophoresis (MST):

    • Particularly suitable for membrane proteins

    • Allows measurement in complex buffers containing detergents

    • Requires only small amounts of labeled protein

    • Can detect weak transient interactions typical of enzyme-substrate pairs

Functional interaction analysis:

  • Pull-down assays with modified conditions:

    • Immobilize tagged HtpX on appropriate resin

    • Incubate with P. abyssi cellular extracts at elevated temperatures

    • Identify bound proteins via mass spectrometry

    • Cross-reference with predicted membrane proteome

    • This approach has been successful for identifying interaction networks of other P. abyssi proteins

  • Co-immunoprecipitation from thermophilic cellular extracts:

    • Generate antibodies against HtpX or use tagged versions

    • Perform immunoprecipitation from P. abyssi lysates

    • Identify co-precipitated proteins using mass spectrometry

    • Validate with reciprocal pull-downs

  • Crosslinking Mass Spectrometry (XL-MS):

    • Use thermostable crosslinkers with varying spacer lengths

    • Apply to mixtures of HtpX and potential substrates

    • Identify crosslinked peptides by MS/MS analysis

    • Map interaction interfaces at amino acid resolution

In vitro proteolysis confirmation:

After identifying potential binding partners, confirm actual substrate relationships through:

  • In vitro proteolysis assays with purified components

  • Time-course analysis of substrate degradation

  • Identification of cleavage sites by N-terminal sequencing or MS analysis

  • Mutation of putative recognition sequences to confirm specificity

These techniques, particularly when used in combination, provide a comprehensive toolkit for elucidating the substrate repertoire and specificity of P. abyssi HtpX under conditions that reflect its native hyperthermophilic environment .

How can researchers effectively study the role of P. abyssi HtpX in stress response pathways using systems biology approaches?

Investigating the role of Pyrococcus abyssi HtpX in stress response pathways requires integrated systems biology approaches that can capture the complexity of cellular networks under extreme conditions. Here is a comprehensive methodology:

Multi-omics integration strategy:

  • Transcriptomics analysis:

    • Perform RNA-seq on P. abyssi under various stress conditions (heat shock, oxidative stress, pH stress)

    • Track htpX expression patterns alongside other stress-responsive genes

    • Identify co-regulated gene clusters through time-course experiments

    • Compare with transcriptome data from related archaea like Archaeoglobus fulgidus where HtpX has been shown to respond to heat shock

  • Proteomics profiling:

    • Quantitative proteomics (TMT or SILAC) to track protein abundance changes

    • Phosphoproteomics to identify stress-activated signaling cascades

    • Protein turnover analysis using pulse-chase labeling to identify HtpX substrates

    • Membrane proteome enrichment techniques to focus on likely HtpX targets

  • Interactomics:

    • Affinity purification-mass spectrometry (AP-MS) with HtpX as bait under different stress conditions

    • Proximity labeling approaches (BioID or APEX) adapted for thermophilic conditions

    • Protein-protein interaction network mapping and comparison before/after stress

    • Cross-reference with interactome data from other archaeal quality control proteins

Functional genomics approaches:

  • Gene manipulation strategies:

    • CRISPR-Cas9 system adapted for P. abyssi to generate htpX knockout or catalytically inactive mutants

    • Overexpression of htpX to assess impact on stress tolerance

    • Complementation studies with htpX variants to identify critical domains

    • Phenotypic characterization under various stress conditions

  • Reporter systems:

    • Develop thermostable fluorescent or luminescent reporters for P. abyssi

    • Create transcriptional fusions to monitor htpX promoter activity in real-time

    • Engineer substrate sensors to track HtpX activity in vivo

Network modeling and integration:

  • Computational network reconstruction:

    • Integrate multi-omics data to build protein quality control network models

    • Perform in silico perturbation analysis to predict system responses

    • Compare network architecture with mesophilic organisms to identify thermophile-specific features

  • Visualization and analysis:

    • Use Cytoscape or similar tools to visualize interaction networks

    • Apply pathway enrichment analysis to identify overrepresented stress pathways

    • Perform differential network analysis between stressed and non-stressed conditions

Validation experiments:

ApproachPurposeExpected Outcome
Growth phenotypingDetermine impact of htpX modification on stress survivalQuantitative stress tolerance profiles
Proteostasis assaysMeasure protein aggregation in htpX mutantsIncreased aggregation in knockout strains under stress
Membrane integrity testsAssess membrane function in stress conditionsCorrelation between HtpX activity and membrane stability
Substrate validationConfirm direct proteolysis of predicted targetsIdentification of physiologically relevant substrates

By implementing this systems biology framework, researchers can develop a comprehensive understanding of how P. abyssi HtpX contributes to maintaining cellular homeostasis under extreme conditions, potentially revealing novel mechanisms of stress adaptation in hyperthermophilic archaea .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.