Recombinant Pyrococcus abyssi Uncharacterized protein PYRAB14350 (PYRAB14350)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Full Length Pyrococcus abyssi Uncharacterized protein PYRAB14350 (PYRAB14350) is a protein derived from the hyperthermophilic archaeon Pyrococcus abyssi . P. abyssi thrives in extreme conditions, such as high temperatures (around 96°C) and anaerobic, high-pressure environments, typically found near deep-sea hydrothermal vents . The protein is expressed in E. coli and fused to an N-terminal His tag to facilitate purification .

Table 1: Protein Overview

FeatureDescription
Cat.No.RFL35742PF
SpeciesPyrococcus abyssi
SourceE. coli
TagHis
Protein LengthFull Length of Mature Protein (24-333)
FormLyophilized powder
AA SequenceAENGYDLIIVRNDDLIDYLIALPYSHLLDIPILPVNPKELDDVTKAQLYSYIQLGRDKILIIGNNNAVSLNVEKELEDMGFKVTRIGGADRTETAEKLALHFYPNGSKLVILASAWDYGSTLAAS EFAMEYKCPILLTWENQLSPSALEGIKKLNPKIVILVGFGINETVEKTIEDMGYETYWIGRDIEPPPIETTTTTTPNQTSSSKSFFLGVLVTLMILSPVIVYLWKKREERRSQF LEQFSEKEIEVLRAIIENGGEIKQEELPKIVGYSRPTISRIIQDLEKKGIVEREKSGKTFIVRVIKKIKLD
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended.
Gene NamePYRAB14350
SynonymsPYRAB14350; PAB0953; Uncharacterized protein PYRAB14350
UniProt IDQ9UYS2

Gene Information

The gene encoding PYRAB14350 is identified as PYRAB14350 and also referred to as PAB0953 . The protein is listed in the UniProt database under the ID Q9UYS2 .

Functional Analysis

As an uncharacterized protein, the precise function of PYRAB14350 is currently unknown . The localization of certain Pyrococcus abyssi genes, such as PAB1135, in the same operon as RNase P subunits suggests involvement in RNA metabolism . Further research may reveal PYRAB14350's specific role within the cellular processes of Pyrococcus abyssi.

Potential Applications

  • ELISA Development: Recombinant PYRAB14350 can be used in Enzyme-Linked Immunosorbent Assays (ELISAs) for research purposes .

  • Structural Studies: The protein can be used to determine its three-dimensional structure and understand its folding and stability.

  • Protein-Protein Interaction Studies: The protein can be utilized to identify and characterize its interacting partners within Pyrococcus abyssi.

  • Enzyme Activity Assays: Although currently uncharacterized, functional assays could be developed to identify any enzymatic activity of PYRAB14350.

Expression and Purification

Recombinant PYRAB14350 is produced in E. coli and purified using affinity chromatography due to its His-tag . This approach allows for efficient isolation of the protein from the bacterial lysate.

L-Asparaginase I

L-asparaginase I from Pyrococcus abyssi has been produced recombinantly and characterized for its anticancer effects . This enzyme has potential as a therapeutic agent due to its high substrate specificity and stability .

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional charge; please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.

Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
PYRAB14350; PAB0953; Uncharacterized protein PYRAB14350
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-333
Protein Length
Full Length of Mature Protein
Species
Pyrococcus abyssi (strain GE5 / Orsay)
Target Names
PYRAB14350
Target Protein Sequence
AENGYDLIIVRNDDLIDYLIALPYSHLLDIPILPVNPKELDDVTKAQLYSYIQLGRDKIL IIGNNNAVSLNVEKELEDMGFKVTRIGGADRTETAEKLALHFYPNGSKLVILASAWDYGS TLAASEFAMEYKCPILLTWENQLSPSALEGIKKLNPKIVILVGFGINETVEKTIEDMGYE TYWIGRDIEPPPIETTTTTTPNQTSSSKSFFLGVLVTLMILSPVIVYLWKKREERRSQFL EQFSEKEIEVLRAIIENGGEIKQEELPKIVGYSRPTISRIIQDLEKKGIVEREKSGKTFI VRVIKKIKLD
Uniprot No.

Target Background

Database Links

KEGG: pab:PAB0953

STRING: 272844.PAB0953

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What expression systems are suitable for producing recombinant PYRAB14350?

For recombinant production of PYRAB14350, E. coli-based expression systems have proven effective. Drawing from similar approaches with other Pyrococcus proteins, the recommended methodology includes:

  • Gene cloning into pET28a(+) or similar expression vectors with an N-terminal His-tag

  • Transformation into E. coli BL21(DE3) Rosetta cells for expression

  • Induction with 0.5mM IPTG, similar to protocols used for other archaeal proteins

  • Cell harvesting and lysis under optimized conditions

  • Purification through heat treatment (leveraging the thermostability of archaeal proteins) and chromatographic methods

This approach has been successfully used for other proteins from Pyrococcus abyssi, yielding high-purity recombinant protein suitable for subsequent analysis . The thermostable nature of archaeal proteins facilitates selective purification through heat-denaturation steps that remove most E. coli host proteins.

What purification protocols are most effective for recombinant PYRAB14350?

A multi-step purification protocol is recommended for obtaining high-purity PYRAB14350:

  • Selective heat denaturation: Heating the cell lysate to 70-80°C for 20-30 minutes exploits the thermostability of the archaeal protein while denaturing most E. coli proteins

  • Immobilized metal affinity chromatography (IMAC): Utilizing the His-tag for initial purification

  • Ion exchange chromatography: Further purification based on charge properties

  • Size exclusion chromatography: Final polishing step if needed for specific applications

This combined approach has been demonstrated effective for other archaeal proteins, achieving greater than 90% purity as determined by SDS-PAGE . The purified protein can be stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, with addition of glycerol (5-50%) recommended for long-term storage at -20°C/-80°C.

What reconstitution methods are optimal for lyophilized PYRAB14350?

For reconstitution of lyophilized PYRAB14350, the following methodological approach is recommended:

  • Briefly centrifuge the vial to ensure the protein powder is at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to a final concentration of 5-50%

  • Aliquot to minimize freeze-thaw cycles

  • Store working aliquots at 4°C (stable for approximately one week)

  • Store long-term aliquots at -20°C/-80°C

Repeated freeze-thaw cycles should be avoided to maintain protein integrity and activity . This approach ensures maximum stability and functionality of the recombinant protein for subsequent experiments.

What approaches can help determine the potential function of PYRAB14350?

For uncharacterized proteins like PYRAB14350, a combined computational and experimental approach is recommended:

Computational approaches:

  • Sequence homology analysis using BLAST against characterized proteins

  • Domain prediction using tools like Pfam, InterPro, and SMART

  • Structure prediction using AlphaFold or similar tools

  • Functional prediction through Gene Ontology term assignment

Experimental approaches:

  • Activity screening against common substrates

  • Pull-down assays to identify interaction partners

  • Structural determination through X-ray crystallography or NMR

  • Comparative analysis with homologous proteins from related archaea

Similar approaches have been used successfully for other archaeal proteins, including enzymes from Pyrococcus species, leading to functional characterization . The combination of in silico and experimental methodologies provides complementary information that can converge on likely functions.

How can researchers assess the thermal stability properties of PYRAB14350?

Given the hyperthermophilic origin of PYRAB14350, characterizing its thermal stability is important. The following methodological approaches are recommended:

  • Differential Scanning Calorimetry (DSC): Determines the melting temperature (Tm) and thermodynamic parameters of unfolding

  • Circular Dichroism (CD) spectroscopy: Monitors secondary structure changes during thermal denaturation

  • Activity assays at different temperatures: Establishes the temperature optima and range for activity

  • Thermal shift assays: Identifies conditions that enhance thermal stability

For hyperthermophilic proteins like those from Pyrococcus abyssi, typical experimental conditions should include temperature ranges of 60-120°C. Studies of other archaeal proteins have shown that many maintain activity at temperatures above 80°C, with optimal activity often observed around 80-100°C .

Temperature (°C)Expected Stability Characteristics for Archaeal Proteins
25-60Highly stable, minimal activity for hyperthermophiles
60-80Increasing activity, maintained structural integrity
80-100Optimal activity range for many Pyrococcus proteins
100-120Gradual activity decline, structural integrity may remain

What structural biology approaches are most suitable for PYRAB14350 characterization?

For comprehensive structural characterization of PYRAB14350, a multi-technique approach is recommended:

  • X-ray crystallography: Provides high-resolution structural information

    • Optimization of crystallization conditions (temperature, pH, precipitants)

    • Data collection at synchrotron radiation facilities

    • Structure determination through molecular replacement or experimental phasing

  • Cryo-electron microscopy: Alternative for structural determination if crystallization proves challenging

    • Sample preparation on grids with vitreous ice

    • High-resolution data collection and processing

    • Model building and refinement

  • Nuclear Magnetic Resonance (NMR): For dynamics and interaction studies

    • Isotopic labeling (13C, 15N) in minimal media

    • Multidimensional NMR experiments for resonance assignment

    • Structure calculation based on distance restraints

  • Small-Angle X-ray Scattering (SAXS): For solution structure and conformational studies

    • Data collection at different protein concentrations

    • Determination of radius of gyration and molecular envelope

    • Validation of crystal structures in solution

Similar structural biology approaches have been successfully applied to other archaeal proteins, revealing important insights into their function and evolutionary adaptations to extreme environments .

How can researchers investigate potential role of PYRAB14350 in multi-protein complexes?

Investigation of PYRAB14350's potential involvement in protein complexes requires specialized approaches:

  • In vitro reconstitution experiments:

    • Combinatorial mixing of purified archaeal proteins

    • Activity assays to detect functional reconstitution

    • Stoichiometry determination through analytical ultracentrifugation

  • Protein-protein interaction screening:

    • Pull-down assays using His-tagged PYRAB14350

    • Crosslinking mass spectrometry to map interaction interfaces

    • Surface plasmon resonance to determine binding kinetics

  • In vivo complex identification:

    • Co-immunoprecipitation from native or reconstituted systems

    • Proximity labeling approaches (BioID, APEX)

    • Native mass spectrometry of intact complexes

These approaches have proven valuable in characterizing other archaeal protein complexes, such as the RNase P complex from Pyrococcus furiosus. Such studies have revealed that archaeal protein complexes often show enhanced functionality compared to their individual components, as demonstrated by reconstitution experiments .

Reconstitution CombinationTypical Effects Observed in Archaeal Systems
Single proteinLimited or no activity
Partial protein complexModerate activity, higher Mg2+ requirement
Complete protein complexMaximal activity, lower Mg2+ requirement

What in silico approaches can predict structure-function relationships for PYRAB14350?

Advanced computational methods can provide valuable insights into PYRAB14350 structure and function:

  • Molecular dynamics simulations:

    • Simulate protein behavior under various conditions (temperature, pH, salt)

    • Identify conformational changes and flexibility regions

    • Characterize potential substrate binding sites and mechanisms

  • Molecular docking studies:

    • Screen potential substrates or ligands

    • Calculate binding energies and interaction surfaces

    • Identify key residues involved in binding

  • Comparative modeling and threading:

    • Build 3D models based on homologous proteins

    • Validate models through energy minimization and Ramachandran analysis

    • Compare with known structures in the Protein Data Bank

  • Evolutionary analysis:

    • Identify conserved residues across homologs

    • Conduct selective pressure analysis to identify functionally important sites

    • Perform co-evolution analysis to predict interaction interfaces

Similar computational approaches applied to other archaeal proteins have provided valuable insights into structure-function relationships. For example, in silico studies of Pyrococcus abyssi asparaginase revealed its homodimeric structure and identified key active site residues with substrate binding properties (ΔG – 4.5 kJ/mole) .

How can researchers design experiments to determine if PYRAB14350 has enzymatic activity?

A systematic approach to investigating potential enzymatic functions of PYRAB14350 includes:

  • Bioinformatic analysis to guide hypothesis generation:

    • Sequence comparison with known enzyme families

    • Identification of potential catalytic motifs or signatures

    • Structural comparison with characterized enzymes

  • High-throughput activity screening:

    • Test against substrate libraries covering major enzyme classes

    • Screen across temperature range (60-100°C) and pH conditions

    • Monitor activity using spectrophotometric, fluorescent, or coupled assays

  • Detailed kinetic characterization:

    • Determine kinetic parameters (Km, kcat, kcat/Km)

    • Study effects of temperature, pH, metal ions on activity

    • Investigate substrate specificity

  • Site-directed mutagenesis:

    • Target predicted catalytic residues

    • Create alanine-scanning mutants of conserved residues

    • Analyze effects on activity and substrate binding

This methodological framework has been successfully applied to other initially uncharacterized archaeal proteins. For example, the characterization of L-asparaginase from Pyrococcus abyssi revealed specific activity of 1175 U/mg, a Km value of 2.05mM, and optimal activity at 80°C and pH 8.0 .

What experimental design would best investigate PYRAB14350's potential role in extremophile adaptation?

To investigate PYRAB14350's potential role in extremophile adaptation, the following experimental design is recommended:

  • Comparative analysis across temperature adaptations:

    • Compare with homologs from mesophilic and psychrophilic organisms

    • Identify specific amino acid compositions or motifs unique to the thermophilic version

    • Conduct parallel functional assays across temperature ranges

  • Pressure adaptation studies:

    • Test protein stability and activity under various pressure conditions

    • Use specialized high-pressure equipment for biochemical assays

    • Compare with homologs from non-barophilic organisms

  • Chimeric protein engineering:

    • Create domain swaps between thermophilic and mesophilic homologs

    • Identify regions responsible for thermostability

    • Test engineered variants for temperature stability and activity

  • Structural analysis under extreme conditions:

    • Perform X-ray crystallography at different temperatures

    • Conduct molecular dynamics simulations under extreme conditions

    • Analyze stabilizing features (ion pairs, hydrophobic cores, disulfide bonds)

  • Cellular context experiments:

    • Expression profiling under different stress conditions

    • Localization studies within the archaeal cell

    • Protein-protein interaction network analysis under stress

These approaches have yielded important insights into extremophile adaptations for other archaeal proteins, revealing molecular mechanisms that enable function under conditions that would denature most proteins from mesophilic organisms .

How can PYRAB14350 potentially contribute to biotechnological applications?

The unique properties of archaeal proteins from extremophiles like Pyrococcus abyssi make them valuable for various biotechnological applications:

  • Biocatalysis under harsh conditions:

    • If enzymatic activity is confirmed, PYRAB14350 could catalyze reactions at high temperatures

    • Potential applications in industries requiring thermostable enzymes (food processing, biofuel production)

    • Methodological approach: Screen activity against industrially relevant substrates

  • Protein engineering platform:

    • Use as a thermostable scaffold for engineering novel functions

    • Creation of chimeric proteins with enhanced stability

    • Methodological approach: Circular permutation, domain insertion, or directed evolution

  • Structural biology tools:

    • Development as crystallization chaperones for difficult-to-crystallize proteins

    • Use in NMR studies as thermostable fusion partners

    • Methodological approach: Fusion protein design and validation

  • Therapeutic potential:

    • Investigation of anticancer or antimicrobial properties

    • Similar archaeal proteins have shown therapeutic potential

    • Methodological approach: Cytotoxicity assays against cancer cell lines

Research on other proteins from Pyrococcus abyssi, such as asparaginase, has demonstrated potential anticancer activity with IC50 values of 5-7.5 U/mL against various cancer cell lines (caco2, HepG2), showing 55-78% growth inhibition at 5 U/mL .

What methodological considerations are important when comparing PYRAB14350 with homologs from other organisms?

Comparative analysis of PYRAB14350 with homologs requires careful methodological considerations:

  • Homology identification:

    • Use sensitive sequence comparison tools (PSI-BLAST, HHpred)

    • Consider structural homology even in the absence of sequence similarity

    • Include diverse organisms spanning all domains of life

  • Alignment quality assessment:

    • Use multiple sequence alignment tools with parameters optimized for distant homologs

    • Manually curate alignments to ensure proper alignment of functional motifs

    • Consider structure-guided alignments for distant relationships

  • Functional comparison standardization:

    • Ensure consistent experimental conditions when comparing across homologs

    • Account for temperature optima differences when comparing kinetic parameters

    • Normalize activity measurements appropriately

  • Structural comparison:

    • Use structural alignment tools (DALI, TM-align) to identify structural conservation

    • Compare active sites and binding pockets

    • Analyze differences in flexible regions and stability-enhancing features

  • Evolutionary analysis:

    • Construct phylogenetic trees using appropriate models for archaeal proteins

    • Consider horizontal gene transfer events common in archaea

    • Analyze rates of evolution across different lineages

These methodological considerations help ensure valid comparisons between PYRAB14350 and its homologs, avoiding artifacts that could arise from comparing proteins adapted to different environmental conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.