Recombinant Full Length Pyrococcus abyssi Uncharacterized protein PYRAB14350 (PYRAB14350) is a protein derived from the hyperthermophilic archaeon Pyrococcus abyssi . P. abyssi thrives in extreme conditions, such as high temperatures (around 96°C) and anaerobic, high-pressure environments, typically found near deep-sea hydrothermal vents . The protein is expressed in E. coli and fused to an N-terminal His tag to facilitate purification .
| Feature | Description |
|---|---|
| Cat.No. | RFL35742PF |
| Species | Pyrococcus abyssi |
| Source | E. coli |
| Tag | His |
| Protein Length | Full Length of Mature Protein (24-333) |
| Form | Lyophilized powder |
| AA Sequence | AENGYDLIIVRNDDLIDYLIALPYSHLLDIPILPVNPKELDDVTKAQLYSYIQLGRDKILIIGNNNAVSLNVEKELEDMGFKVTRIGGADRTETAEKLALHFYPNGSKLVILASAWDYGSTLAAS EFAMEYKCPILLTWENQLSPSALEGIKKLNPKIVILVGFGINETVEKTIEDMGYETYWIGRDIEPPPIETTTTTTPNQTSSSKSFFLGVLVTLMILSPVIVYLWKKREERRSQF LEQFSEKEIEVLRAIIENGGEIKQEELPKIVGYSRPTISRIIQDLEKKGIVEREKSGKTFIVRVIKKIKLD |
| Purity | Greater than 90% as determined by SDS-PAGE |
| Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles. |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended. |
| Gene Name | PYRAB14350 |
| Synonyms | PYRAB14350; PAB0953; Uncharacterized protein PYRAB14350 |
| UniProt ID | Q9UYS2 |
The gene encoding PYRAB14350 is identified as PYRAB14350 and also referred to as PAB0953 . The protein is listed in the UniProt database under the ID Q9UYS2 .
As an uncharacterized protein, the precise function of PYRAB14350 is currently unknown . The localization of certain Pyrococcus abyssi genes, such as PAB1135, in the same operon as RNase P subunits suggests involvement in RNA metabolism . Further research may reveal PYRAB14350's specific role within the cellular processes of Pyrococcus abyssi.
ELISA Development: Recombinant PYRAB14350 can be used in Enzyme-Linked Immunosorbent Assays (ELISAs) for research purposes .
Structural Studies: The protein can be used to determine its three-dimensional structure and understand its folding and stability.
Protein-Protein Interaction Studies: The protein can be utilized to identify and characterize its interacting partners within Pyrococcus abyssi.
Enzyme Activity Assays: Although currently uncharacterized, functional assays could be developed to identify any enzymatic activity of PYRAB14350.
Recombinant PYRAB14350 is produced in E. coli and purified using affinity chromatography due to its His-tag . This approach allows for efficient isolation of the protein from the bacterial lysate.
L-asparaginase I from Pyrococcus abyssi has been produced recombinantly and characterized for its anticancer effects . This enzyme has potential as a therapeutic agent due to its high substrate specificity and stability .
KEGG: pab:PAB0953
STRING: 272844.PAB0953
For recombinant production of PYRAB14350, E. coli-based expression systems have proven effective. Drawing from similar approaches with other Pyrococcus proteins, the recommended methodology includes:
Gene cloning into pET28a(+) or similar expression vectors with an N-terminal His-tag
Transformation into E. coli BL21(DE3) Rosetta cells for expression
Induction with 0.5mM IPTG, similar to protocols used for other archaeal proteins
Cell harvesting and lysis under optimized conditions
Purification through heat treatment (leveraging the thermostability of archaeal proteins) and chromatographic methods
This approach has been successfully used for other proteins from Pyrococcus abyssi, yielding high-purity recombinant protein suitable for subsequent analysis . The thermostable nature of archaeal proteins facilitates selective purification through heat-denaturation steps that remove most E. coli host proteins.
A multi-step purification protocol is recommended for obtaining high-purity PYRAB14350:
Selective heat denaturation: Heating the cell lysate to 70-80°C for 20-30 minutes exploits the thermostability of the archaeal protein while denaturing most E. coli proteins
Immobilized metal affinity chromatography (IMAC): Utilizing the His-tag for initial purification
Ion exchange chromatography: Further purification based on charge properties
Size exclusion chromatography: Final polishing step if needed for specific applications
This combined approach has been demonstrated effective for other archaeal proteins, achieving greater than 90% purity as determined by SDS-PAGE . The purified protein can be stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, with addition of glycerol (5-50%) recommended for long-term storage at -20°C/-80°C.
For reconstitution of lyophilized PYRAB14350, the following methodological approach is recommended:
Briefly centrifuge the vial to ensure the protein powder is at the bottom
Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL
For long-term storage, add glycerol to a final concentration of 5-50%
Aliquot to minimize freeze-thaw cycles
Store working aliquots at 4°C (stable for approximately one week)
Store long-term aliquots at -20°C/-80°C
Repeated freeze-thaw cycles should be avoided to maintain protein integrity and activity . This approach ensures maximum stability and functionality of the recombinant protein for subsequent experiments.
For uncharacterized proteins like PYRAB14350, a combined computational and experimental approach is recommended:
Computational approaches:
Sequence homology analysis using BLAST against characterized proteins
Domain prediction using tools like Pfam, InterPro, and SMART
Structure prediction using AlphaFold or similar tools
Functional prediction through Gene Ontology term assignment
Experimental approaches:
Activity screening against common substrates
Pull-down assays to identify interaction partners
Structural determination through X-ray crystallography or NMR
Comparative analysis with homologous proteins from related archaea
Similar approaches have been used successfully for other archaeal proteins, including enzymes from Pyrococcus species, leading to functional characterization . The combination of in silico and experimental methodologies provides complementary information that can converge on likely functions.
Given the hyperthermophilic origin of PYRAB14350, characterizing its thermal stability is important. The following methodological approaches are recommended:
Differential Scanning Calorimetry (DSC): Determines the melting temperature (Tm) and thermodynamic parameters of unfolding
Circular Dichroism (CD) spectroscopy: Monitors secondary structure changes during thermal denaturation
Activity assays at different temperatures: Establishes the temperature optima and range for activity
Thermal shift assays: Identifies conditions that enhance thermal stability
For hyperthermophilic proteins like those from Pyrococcus abyssi, typical experimental conditions should include temperature ranges of 60-120°C. Studies of other archaeal proteins have shown that many maintain activity at temperatures above 80°C, with optimal activity often observed around 80-100°C .
| Temperature (°C) | Expected Stability Characteristics for Archaeal Proteins |
|---|---|
| 25-60 | Highly stable, minimal activity for hyperthermophiles |
| 60-80 | Increasing activity, maintained structural integrity |
| 80-100 | Optimal activity range for many Pyrococcus proteins |
| 100-120 | Gradual activity decline, structural integrity may remain |
For comprehensive structural characterization of PYRAB14350, a multi-technique approach is recommended:
X-ray crystallography: Provides high-resolution structural information
Optimization of crystallization conditions (temperature, pH, precipitants)
Data collection at synchrotron radiation facilities
Structure determination through molecular replacement or experimental phasing
Cryo-electron microscopy: Alternative for structural determination if crystallization proves challenging
Sample preparation on grids with vitreous ice
High-resolution data collection and processing
Model building and refinement
Nuclear Magnetic Resonance (NMR): For dynamics and interaction studies
Isotopic labeling (13C, 15N) in minimal media
Multidimensional NMR experiments for resonance assignment
Structure calculation based on distance restraints
Small-Angle X-ray Scattering (SAXS): For solution structure and conformational studies
Data collection at different protein concentrations
Determination of radius of gyration and molecular envelope
Validation of crystal structures in solution
Similar structural biology approaches have been successfully applied to other archaeal proteins, revealing important insights into their function and evolutionary adaptations to extreme environments .
Investigation of PYRAB14350's potential involvement in protein complexes requires specialized approaches:
In vitro reconstitution experiments:
Combinatorial mixing of purified archaeal proteins
Activity assays to detect functional reconstitution
Stoichiometry determination through analytical ultracentrifugation
Protein-protein interaction screening:
Pull-down assays using His-tagged PYRAB14350
Crosslinking mass spectrometry to map interaction interfaces
Surface plasmon resonance to determine binding kinetics
In vivo complex identification:
Co-immunoprecipitation from native or reconstituted systems
Proximity labeling approaches (BioID, APEX)
Native mass spectrometry of intact complexes
These approaches have proven valuable in characterizing other archaeal protein complexes, such as the RNase P complex from Pyrococcus furiosus. Such studies have revealed that archaeal protein complexes often show enhanced functionality compared to their individual components, as demonstrated by reconstitution experiments .
| Reconstitution Combination | Typical Effects Observed in Archaeal Systems |
|---|---|
| Single protein | Limited or no activity |
| Partial protein complex | Moderate activity, higher Mg2+ requirement |
| Complete protein complex | Maximal activity, lower Mg2+ requirement |
Advanced computational methods can provide valuable insights into PYRAB14350 structure and function:
Molecular dynamics simulations:
Simulate protein behavior under various conditions (temperature, pH, salt)
Identify conformational changes and flexibility regions
Characterize potential substrate binding sites and mechanisms
Molecular docking studies:
Screen potential substrates or ligands
Calculate binding energies and interaction surfaces
Identify key residues involved in binding
Comparative modeling and threading:
Build 3D models based on homologous proteins
Validate models through energy minimization and Ramachandran analysis
Compare with known structures in the Protein Data Bank
Evolutionary analysis:
Identify conserved residues across homologs
Conduct selective pressure analysis to identify functionally important sites
Perform co-evolution analysis to predict interaction interfaces
Similar computational approaches applied to other archaeal proteins have provided valuable insights into structure-function relationships. For example, in silico studies of Pyrococcus abyssi asparaginase revealed its homodimeric structure and identified key active site residues with substrate binding properties (ΔG – 4.5 kJ/mole) .
A systematic approach to investigating potential enzymatic functions of PYRAB14350 includes:
Bioinformatic analysis to guide hypothesis generation:
Sequence comparison with known enzyme families
Identification of potential catalytic motifs or signatures
Structural comparison with characterized enzymes
High-throughput activity screening:
Test against substrate libraries covering major enzyme classes
Screen across temperature range (60-100°C) and pH conditions
Monitor activity using spectrophotometric, fluorescent, or coupled assays
Detailed kinetic characterization:
Determine kinetic parameters (Km, kcat, kcat/Km)
Study effects of temperature, pH, metal ions on activity
Investigate substrate specificity
Site-directed mutagenesis:
Target predicted catalytic residues
Create alanine-scanning mutants of conserved residues
Analyze effects on activity and substrate binding
This methodological framework has been successfully applied to other initially uncharacterized archaeal proteins. For example, the characterization of L-asparaginase from Pyrococcus abyssi revealed specific activity of 1175 U/mg, a Km value of 2.05mM, and optimal activity at 80°C and pH 8.0 .
To investigate PYRAB14350's potential role in extremophile adaptation, the following experimental design is recommended:
Comparative analysis across temperature adaptations:
Compare with homologs from mesophilic and psychrophilic organisms
Identify specific amino acid compositions or motifs unique to the thermophilic version
Conduct parallel functional assays across temperature ranges
Pressure adaptation studies:
Test protein stability and activity under various pressure conditions
Use specialized high-pressure equipment for biochemical assays
Compare with homologs from non-barophilic organisms
Chimeric protein engineering:
Create domain swaps between thermophilic and mesophilic homologs
Identify regions responsible for thermostability
Test engineered variants for temperature stability and activity
Structural analysis under extreme conditions:
Perform X-ray crystallography at different temperatures
Conduct molecular dynamics simulations under extreme conditions
Analyze stabilizing features (ion pairs, hydrophobic cores, disulfide bonds)
Cellular context experiments:
Expression profiling under different stress conditions
Localization studies within the archaeal cell
Protein-protein interaction network analysis under stress
These approaches have yielded important insights into extremophile adaptations for other archaeal proteins, revealing molecular mechanisms that enable function under conditions that would denature most proteins from mesophilic organisms .
The unique properties of archaeal proteins from extremophiles like Pyrococcus abyssi make them valuable for various biotechnological applications:
Biocatalysis under harsh conditions:
If enzymatic activity is confirmed, PYRAB14350 could catalyze reactions at high temperatures
Potential applications in industries requiring thermostable enzymes (food processing, biofuel production)
Methodological approach: Screen activity against industrially relevant substrates
Protein engineering platform:
Use as a thermostable scaffold for engineering novel functions
Creation of chimeric proteins with enhanced stability
Methodological approach: Circular permutation, domain insertion, or directed evolution
Structural biology tools:
Development as crystallization chaperones for difficult-to-crystallize proteins
Use in NMR studies as thermostable fusion partners
Methodological approach: Fusion protein design and validation
Therapeutic potential:
Investigation of anticancer or antimicrobial properties
Similar archaeal proteins have shown therapeutic potential
Methodological approach: Cytotoxicity assays against cancer cell lines
Research on other proteins from Pyrococcus abyssi, such as asparaginase, has demonstrated potential anticancer activity with IC50 values of 5-7.5 U/mL against various cancer cell lines (caco2, HepG2), showing 55-78% growth inhibition at 5 U/mL .
Comparative analysis of PYRAB14350 with homologs requires careful methodological considerations:
Homology identification:
Use sensitive sequence comparison tools (PSI-BLAST, HHpred)
Consider structural homology even in the absence of sequence similarity
Include diverse organisms spanning all domains of life
Alignment quality assessment:
Use multiple sequence alignment tools with parameters optimized for distant homologs
Manually curate alignments to ensure proper alignment of functional motifs
Consider structure-guided alignments for distant relationships
Functional comparison standardization:
Ensure consistent experimental conditions when comparing across homologs
Account for temperature optima differences when comparing kinetic parameters
Normalize activity measurements appropriately
Structural comparison:
Use structural alignment tools (DALI, TM-align) to identify structural conservation
Compare active sites and binding pockets
Analyze differences in flexible regions and stability-enhancing features
Evolutionary analysis:
Construct phylogenetic trees using appropriate models for archaeal proteins
Consider horizontal gene transfer events common in archaea
Analyze rates of evolution across different lineages
These methodological considerations help ensure valid comparisons between PYRAB14350 and its homologs, avoiding artifacts that could arise from comparing proteins adapted to different environmental conditions .