Recombinant Pyrococcus abyssi UPF0056 membrane protein PYRAB02000 (PYRAB02000)

Shipped with Ice Packs
In Stock

Description

Genomic Context and Classification

PYRAB02000 is encoded by the gene PYRAB02000 (also annotated as PAB2220) in the genome of Pyrococcus abyssi, a hyperthermophilic archaeon isolated from deep-sea hydrothermal vents . The protein belongs to the Uncharacterized Protein Family 0056 (UPF0056), a group of conserved membrane proteins with limited functional annotation. While its exact biological role remains unknown, genomic proximity to other operons (e.g., ribonuclease P components in related species) suggests potential involvement in RNA metabolism or membrane-associated processes .

Recombinant Production and Purification

PYRAB02000 is heterologously expressed in Escherichia coli using plasmid vectors (e.g., pET28a) under T7 promoters . Key production parameters include:

  • Host Strain: E. coli Rosetta (DE3) pLysS or BL21 (DE3)

  • Purification: Affinity chromatography (e.g., His-tag), followed by tag cleavage (thrombin)

  • Solubility: Produced in soluble form, stabilized by Tris-based buffers with 50% glycerol

  • Yield: Typically 50 µg per batch (commercial availability)

Stability:

  • Retains activity after multiple freeze-thaw cycles when stored at -20°C to -80°C .

  • Working aliquots remain stable for 1 week at 4°C .

Functional Hypotheses

While direct functional data for PYRAB02000 is limited, insights from related proteins suggest:

  • Membrane Protein Assembly: Structural homology to UPF0201 proteins implies potential roles in membrane protein insertion or RNA binding .

  • Thermostability: Like other P. abyssi enzymes (e.g., lysophospholipases and asparaginases ), PYRAB02000 likely retains stability at high temperatures (>65°C) .

  • Non-Enzymatic Activity: Absence of catalytic motifs supports hypotheses of structural or regulatory roles .

Research Applications and Future Directions

  • Structural Studies: Cryo-EM or X-ray crystallography to resolve membrane-associated conformations .

  • Interaction Mapping: Mass photometry or cross-linking assays to identify binding partners .

  • Biotechnological Potential: Exploration in thermostable enzyme systems or synthetic biology .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
PYRAB02000; PAB2220; UPF0056 membrane protein PYRAB02000
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Pyrococcus abyssi (strain GE5 / Orsay)
Target Names
PYRAB02000
Target Protein Sequence
MLQEILSSALLMLIMIDPSDKILLVSLLREDFHIEDVKSLIIRANIIGFLLLLIFAVAGK IILQDIFHIELDALRVAGGFVLFKIGLEALESGGMVTIKKEKNILALAAVPVATPLIAGP AAITAAITLTAEYGIVVSVTATFIAIVITAVLMLLSLYLMRGINKTALSVTIRIIGLFIM AIGAQMMISGAGGIVLSILKEA
Uniprot No.

Target Background

Database Links

KEGG: pab:PAB2220

STRING: 272844.PAB2220

Protein Families
UPF0056 (MarC) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Pyrococcus abyssi UPF0056 membrane protein PYRAB02000 and why is it significant for research?

Pyrococcus abyssi UPF0056 membrane protein PYRAB02000 (UniProt ID: Q9V274) is a membrane-associated protein from the hyperthermophilic archaeon Pyrococcus abyssi strain GE5/Orsay. This protein belongs to the UPF0056 family with the gene designation PYRAB02000 (also known as PAB2220) . Its significance for research stems from several factors:

  • It represents a model system for studying membrane proteins from extremophiles

  • The hyperthermophilic nature of the source organism makes its proteins valuable for structural stability studies

  • As an archaeal protein, it provides insights into evolutionary relationships between prokaryotic and eukaryotic membrane proteins

  • The protein's thermal stability creates opportunities for structural biology applications

The complete amino acid sequence of this protein consists of 202 amino acids with several transmembrane domains, making it an interesting subject for membrane protein topology studies .

What are the optimal storage conditions for preserving the structural integrity of recombinant PYRAB02000?

For optimal storage of recombinant PYRAB02000, researchers should follow these evidence-based protocols:

  • Short-term storage (1-7 days): Maintain at 4°C in Tris-based buffer with 50% glycerol

  • Medium-term storage (weeks to months): Store at -20°C in aliquots to avoid repeated freeze-thaw cycles

  • Long-term storage (months to years): Conserve at -80°C in small aliquots (50-100 μl) with stabilizing agents

It's important to note that repeated freezing and thawing should be avoided as this can significantly compromise protein integrity . Based on protocols established for other Pyrococcus abyssi proteins, adding glycerol to a final concentration of 10-50% v/v significantly enhances stability during storage . For research requiring preserved enzymatic activity, inclusion of 2 mM DTT and 0.5 mM EDTA in the storage buffer is recommended based on established protocols for other P. abyssi proteins .

Experimental Methods for Expression and Purification

Purification of PYRAB02000 requires specialized approaches to address the challenges inherent in membrane protein isolation:

  • Initial Solubilization: Use a combination of non-ionic detergents (n-dodecyl-β-D-maltoside or Triton X-100) at concentrations just above their critical micelle concentration (CMC) to extract the protein from membranes without denaturation .

  • Thermal Precipitation Step: Leverage the exceptional thermostability of P. abyssi proteins by heating the crude extract to 75-80°C for 15 minutes, followed by centrifugation to remove denatured E. coli proteins .

  • Chromatographic Purification: Implement a two-step chromatography approach:

    • First step: Anion-exchange chromatography using Source Q column with elution centered around 0.1 M NaCl

    • Second step: Hydroxyapatite chromatography with elution centered at approximately 100 mM potassium phosphate

  • Alternative Approach: Consider the computational design of soluble analogues of the membrane protein using methodologies like AF2seq-MPNN as described for other membrane proteins, which may facilitate structural and functional studies without the challenges of membrane protein purification .

The thermal precipitation step is particularly effective for P. abyssi proteins, as demonstrated by the successful purification of other proteins from this organism with yields of 0.8-5 mg per liter of bacterial culture .

How can researchers assess the purity and structural integrity of purified PYRAB02000?

Multiple complementary methods should be employed to comprehensively assess both purity and structural integrity of purified PYRAB02000:

  • Purity Assessment:

    • SDS-PAGE with Coomassie blue staining to visualize major contaminants

    • Size exclusion chromatography coupled to multi-angle light scattering to verify monodispersity and absence of aggregates

    • Mass spectrometry to confirm protein identity and detect post-translational modifications

  • Structural Integrity Verification:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Tryptophan fluorescence to monitor tertiary structure

    • Thermal shift assays to determine protein stability at different temperatures, particularly valuable for this thermostable protein

  • Functional Assays:

    • Interaction studies with known binding partners (if established)

    • Activity assays (if enzymatic function is known)

    • Membrane reconstitution experiments to assess proper folding in a lipid environment

For thermostable proteins like those from P. abyssi, the heat treatment test (incubation at elevated temperatures followed by size exclusion chromatography) provides a particularly informative assessment of structural integrity . This approach has been validated for other P. abyssi proteins and offers insights into both purity and structural integrity simultaneously.

What approaches are most effective for determining the structure of PYRAB02000?

Determining the structure of membrane proteins like PYRAB02000 presents unique challenges that require specialized approaches:

  • X-ray Crystallography:

    • Employ specialized crystallization screens designed for membrane proteins

    • Consider the lipidic cubic phase (LCP) method which has proven successful for many membrane proteins

    • Use detergent screening to identify optimal solubilization conditions for crystallization

  • Cryo-Electron Microscopy (Cryo-EM):

    • Particularly valuable for membrane proteins that resist crystallization

    • Requires optimization of grid preparation and vitrification conditions

    • Often beneficial to reconstitute the protein in nanodiscs or other membrane mimetics

  • NMR Spectroscopy:

    • Suitable for smaller membrane proteins or domains

    • Requires isotopic labeling (15N, 13C) during expression

    • May provide valuable dynamics information not available from static structures

  • Computational Approaches:

    • Deep learning-based structure prediction (AlphaFold2 or similar tools)

    • Design of soluble analogues using AF2seq-MPNN methodology as demonstrated for other membrane proteins

    • The recent advances in computational design of soluble membrane protein analogues suggest potential application to PYRAB02000, as similar approaches have produced stable, accurate structures for complex membrane proteins

For PYRAB02000 specifically, its thermostability provides an advantage for structural studies, as it may remain stable during the often lengthy procedures required for structural determination. The computational design of soluble analogues represents a particularly promising approach, as demonstrated for other membrane proteins with similar complexity .

How can researchers investigate protein-protein interactions involving PYRAB02000?

Investigating protein-protein interactions for membrane proteins like PYRAB02000 requires specialized techniques:

  • Pull-down Assays:

    • Use hexa-histidine tagged PYRAB02000 bound to Co2+ magnetic microbeads

    • Incubate with cell-free extracts from P. abyssi cultures

    • Wash extensively and elute bound proteins for analysis by SDS-PAGE and mass spectrometry

    • This approach has successfully identified interaction partners for other P. abyssi proteins

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified PYRAB02000 on a sensor chip

    • Flow potential interaction partners over the surface

    • Quantify binding kinetics and affinities

    • Particularly useful for determining the strength of interactions

  • Crosslinking Studies:

    • Use chemical crosslinkers with different spacer lengths

    • Identify crosslinked products by SDS-PAGE and mass spectrometry

    • Particularly valuable for capturing transient interactions

  • Co-immunoprecipitation with Archaeal PCNA:

    • Based on the finding that several P. abyssi proteins interact with PCNA

    • Use anti-PCNA antibodies to co-precipitate potential interaction partners

    • Verify by Western blotting or mass spectrometry

For archaeal proteins like PYRAB02000, examining interactions with the replication clamp PCNA may be particularly informative, as several P. abyssi proteins have been shown to interact with this central component of the replication machinery . The pull-down methodology using hexa-histidine tagged proteins has successfully identified multiple interaction partners for other P. abyssi proteins, suggesting its potential utility for PYRAB02000 .

What functional assays can be used to characterize the biological role of PYRAB02000?

The biological role of PYRAB02000 can be investigated through multiple complementary functional assays:

  • Membrane Association Studies:

    • Reconstitution into liposomes of varying lipid composition

    • Monitoring protein insertion orientation using protease accessibility assays

    • Assessing membrane perturbation potential through dye-leakage assays

  • Genetic Approaches:

    • Analysis of gene neighborhood and operonic organization in P. abyssi genome

    • Gene knockout or depletion studies in model archaeal systems

    • Complementation experiments to confirm gene function

  • Comparative Genomics:

    • Identification of homologs across different species

    • Analysis of evolutionary conservation patterns

    • Prediction of function based on conserved domains or motifs

  • Investigation of Potential PCNA Interaction:

    • Given that several P. abyssi proteins interact with PCNA , investigate if PYRAB02000 contains a PCNA-interaction peptide (PIP) motif

    • Test direct binding between purified PYRAB02000 and P. abyssi PCNA

    • Examine if PYRAB02000 enhances PCNA-dependent activities

For membrane proteins of unknown function like PYRAB02000, combining these approaches provides complementary insights. The evolutionary conservation of membrane proteins across archaeal species often points to fundamental cellular roles, while direct biochemical assays can confirm specific functions hypothesized from sequence analysis or structural studies.

How can computational approaches enhance experimental studies of PYRAB02000?

Computational approaches offer powerful complements to experimental studies of PYRAB02000:

  • Structure Prediction and Analysis:

    • Apply AlphaFold2 or RoseTTAFold to predict the tertiary structure

    • Use molecular dynamics simulations to study membrane insertion and stability

    • Identify potential ligand binding sites through computational pocket detection

  • Design of Soluble Analogues:

    • The AF2seq-MPNN methodology has successfully created soluble versions of membrane proteins while maintaining their fold

    • This approach could enable structural and functional studies without the challenges of membrane protein purification

    • The design protocol has been validated for complex membrane proteins including GPCRs

  • Comparative Sequence Analysis:

    • Multiple sequence alignment to identify conserved residues

    • Evolutionary coupling analysis to detect co-evolving residues that may indicate structural contacts

    • These analyses can guide targeted mutagenesis experiments

  • Molecular Docking:

    • Predict interactions with potential binding partners

    • Virtual screening for small molecule interactions

    • Design improved binding assays based on computational predictions

The design of soluble analogues represents a particularly promising approach for PYRAB02000, as similar methodologies have successfully created stable, monodisperse proteins that retain the structural features of their membrane-bound counterparts . For instance, the AF2seq-MPNN pipeline has been used to design soluble analogues of complex membrane protein folds with as low as 8% sequence identity to natural proteins while maintaining the target fold .

What experimental considerations are important when working with proteins from hyperthermophilic organisms like P. abyssi?

Working with proteins from hyperthermophilic organisms like P. abyssi requires specialized experimental considerations:

  • Temperature Optimization:

    • Standard assay temperatures (37°C) may yield suboptimal activity

    • Conduct activity assays at elevated temperatures (60-95°C) to determine temperature optima

    • Consider thermal stability during all experimental steps including purification and storage

  • Buffer Considerations:

    • Use buffers with temperature-stable pKa values (like phosphate buffers)

    • pH of many buffers changes significantly with temperature, requiring careful adjustment

    • Include stabilizing agents like glycerol (10-50%) for long-term stability

  • Equipment Adaptation:

    • Ensure spectrophotometers, PCR machines, or other equipment can accommodate high temperature requirements

    • Use sealed reaction vessels to prevent evaporation during high-temperature incubations

    • Consider specialized equipment designed for thermophilic enzyme work

  • Cofactor Requirements:

    • Many archaeal proteins require specific cofactors like metal ions (particularly Mg2+, Mn2+, or Fe2+)

    • Test activity with various cofactors at different concentrations

    • Consider the potential need for archaeal-specific lipids or other cellular components

The exceptional thermostability of P. abyssi proteins can be leveraged during purification by incorporating a heat treatment step (75-80°C for 15 minutes) to remove contaminating E. coli proteins . This step has been successfully employed in the purification of other P. abyssi proteins, resulting in significant enrichment of the target protein .

How can researchers develop soluble analogues of PYRAB02000 for easier structural and functional studies?

Developing soluble analogues of membrane proteins like PYRAB02000 offers significant advantages for structural and functional studies:

  • Computational Design Strategy:

    • Use the AF2seq-MPNN pipeline which combines AlphaFold2 structure prediction with MPNN sequence design

    • Redesign the hydrophobic membrane-spanning regions to create water-soluble interfaces

    • Filter designs based on predicted confidence scores and sequence novelty

  • Design Optimization Considerations:

    • Target a low fraction of surface hydrophobics to enhance solubility

    • Maintain the core structural elements to preserve functional properties

    • Generate multiple design variants with sequence identities as low as 8-13% compared to the native protein

  • Experimental Validation Pipeline:

    • Express designed proteins in E. coli

    • Assess solubility and monodispersity by size exclusion chromatography

    • Verify structural integrity through circular dichroism and thermal stability assays

    • Compare functional properties with the native membrane protein

  • Structural Confirmation:

    • Determine X-ray crystal structures of successful designs to validate the approach

    • Compare with computational models to assess prediction accuracy

    • Use successful designs as platforms for further studies

This approach has been successfully applied to complex membrane protein folds including claudins, rhomboid proteases, and GPCRs, generating soluble proteins with RMSDsCα ranging from 2.84-4.03Å compared to the design models . The methodology allows exploration of diverse sequence spaces while maintaining the essential structural features of the membrane protein fold, enabling structural and functional studies without the challenges inherent in membrane protein biochemistry .

How can researchers address protein aggregation issues during expression and purification of PYRAB02000?

Protein aggregation is a common challenge when working with membrane proteins like PYRAB02000. Systematic approaches can address this issue:

  • Expression Optimization:

    • Reduce expression temperature to 16-25°C after induction

    • Lower IPTG concentration (0.1-0.5 mM instead of 1 mM)

    • Consider co-expression with chaperones specific for membrane proteins

    • Use specialized E. coli strains designed for membrane protein expression

  • Solubilization Strategy Refinement:

    • Test a panel of detergents including DDM, LDAO, DM, and Triton X-100

    • Optimize detergent concentration using concentrations just above the critical micelle concentration (CMC)

    • Consider detergent mixtures which can sometimes be more effective than single detergents

    • Include glycerol (10-20%) to stabilize the protein during solubilization

  • Purification Adjustments:

    • Maintain detergent above CMC throughout all purification steps

    • Use size exclusion chromatography as a final polishing step to remove aggregates

    • Consider on-column refolding for proteins that form inclusion bodies

    • Add stabilizing agents like glycerol (10-50%) to all buffers

  • Alternative Approach:

    • Develop soluble analogues using computational design methods like AF2seq-MPNN

    • This approach has successfully addressed aggregation issues for other complex membrane proteins

    • Soluble analogues maintain the fold but eliminate the need for detergents

The purification protocol established for other P. abyssi proteins, which includes a thermal precipitation step (75-80°C for 15 minutes) followed by anion-exchange and hydroxyapatite chromatography, has been shown to produce non-aggregated, functional proteins . This approach leverages the thermostability of archaeal proteins to remove contaminating proteins and potentially misfolded forms of the target protein.

What strategies can overcome expression challenges for toxic membrane proteins like PYRAB02000?

Membrane protein toxicity to expression hosts can significantly limit yields. Several specialized strategies can address this challenge:

  • Expression System Optimization:

    • Use tightly regulated expression systems (like pET with lacI^q)

    • Consider specialized E. coli strains like C41(DE3) or C43(DE3) specifically developed for toxic membrane proteins

    • Evaluate archaeal expression hosts that may better tolerate archaeal membrane proteins

    • Balance between induction strength and toxicity by optimizing IPTG concentration and induction temperature

  • Fusion Protein Approaches:

    • Express as fusion with highly soluble partners (MBP, SUMO, or TrxA)

    • Include purification tags that enhance solubility

    • Engineer cleavable linkers to remove fusion partners after expression

    • Design constructs with periplasmic targeting if appropriate

  • Co-expression Strategies:

    • Co-express with appropriate chaperones to improve folding

    • Consider co-expression of interacting partners that might stabilize the protein

    • Evaluate co-expression of archaeal-specific factors that may facilitate proper folding

  • Cell-free Expression Systems:

    • Bypass toxicity issues completely by using cell-free expression

    • Supplement with appropriate detergents or lipids during synthesis

    • Optimize reaction conditions for archaeal proteins (including temperature)

    • Direct synthesis into artificial membranes or nanodiscs

For archaeal proteins specifically, the approach used for P. abyssi Replication Factor C components provides valuable insights. This approach involved co-expression of multiple protein components that form a complex, resulting in significantly improved solubility compared to expressing individual components . The small subunit of RFC could be expressed and purified individually, while the large subunit was completely insoluble when expressed alone , demonstrating the value of co-expression strategies.

How can researchers validate that recombinant PYRAB02000 retains native structure and function?

Validating that recombinant PYRAB02000 retains native structure and function requires multiple complementary approaches:

  • Structural Integrity Assessment:

    • Compare circular dichroism (CD) spectra with predictions based on computational models

    • Perform limited proteolysis to assess proper folding (properly folded proteins typically show discrete digestion patterns)

    • Use intrinsic fluorescence to monitor tertiary structure integrity

    • Employ differential scanning calorimetry to determine thermal stability profiles

  • Membrane Insertion Validation:

    • Reconstitute into liposomes and assess insertion using protease accessibility assays

    • Measure protein-induced changes in membrane fluidity or permeability

    • Compare lipid interactions with computational predictions

    • Visualize membrane insertion using electron microscopy after reconstitution

  • Functional Assays:

    • If specific functions are known, conduct direct activity assays

    • Test interaction with known binding partners using pull-down assays or SPR

    • Examine potential interactions with the archaeal replisome components, particularly PCNA, as observed for other P. abyssi proteins

    • Assess if the recombinant protein complements deletion mutants in model organisms

  • Comparative Approach:

    • Compare properties with naturally expressed protein (if available)

    • Benchmark against other UPF0056 family proteins with characterized functions

    • Use bioinformatic predictions to guide functional testing

    • Consider developing soluble analogues and comparing their properties with the membrane-bound form

The pull-down methodology using hexa-histidine tagged proteins has successfully identified multiple interaction partners for other P. abyssi proteins, providing a valuable approach to functional validation . Additionally, the AF2seq-MPNN methodology for developing soluble analogues offers an alternative approach to functional characterization when working with challenging membrane proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.