Recombinant Pyrococcus abyssi UPF0290 protein PYRAB16220 (PYRAB16220)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

The protein is synthesized in E. coli systems, leveraging the organism’s ability to express thermostable archaeal proteins in soluble form . Production involves:

  • Induction: Optimized IPTG concentrations (e.g., 0.5 mM) .

  • Purification: Sequential heat denaturation (to remove host proteins) and ion-exchange chromatography .

  • Storage: Tris-based buffer with 50% glycerol at -20°C or -80°C; repeated freeze-thaw cycles are discouraged .

Table 1: Key Production Parameters

ParameterDetail
Expression SystemE. coli
Tag TypeDetermined post-production
Purity>90% (estimated)
Yield50 µg standard batch
Stability≥1 week at 4°C (working aliquot)

Functional and Biochemical Insights

While direct functional data for PYRAB16220 is limited, homologous P. abyssi proteins provide context:

  • Thermostability: Enzymes like lysophospholipases and asparaginases from P. abyssi retain activity at 65–95°C , suggesting PYRAB16220 may share similar resilience.

  • Metal Independence: Some P. abyssi hydrolases function without metal ion cofactors , a trait potentially relevant to PYRAB16220.

  • Substrate Specificity: UPF0290 family proteins often target lipids or nucleic acids, though experimental validation is pending .

Industrial and Research Applications

Recombinant P. abyssi proteins are valued for:

  • Biocatalysis: Thermostable enzymes enhance processes like starch processing and vegetable oil degumming .

  • Therapeutics: Asparaginases from P. abyssi show anticancer activity (IC₅₀: 5–7.5 U/mL against Caco2 and HepG2 cells) .

  • Protein Engineering: Truncation of flexible residues in homologs improves thermostability (e.g., 5.8-fold half-life increase at 65°C) , a strategy applicable to PYRAB16220.

Challenges and Research Gaps

  • Functional Annotation: The UPF0290 family’s role in P. abyssi metabolism is unconfirmed .

  • Structural Data: No crystallographic or cryo-EM structures are available for PYRAB16220, limiting mechanistic insights .

  • Optimization: Tagging strategies and codon optimization for enhanced soluble yield require further study .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes and we will do our best to fulfill your request.
Lead Time
Delivery timelines may vary based on purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All protein shipments are accompanied by standard blue ice packs. If dry ice shipping is required, please contact us in advance to arrange the necessary arrangements and associated fees.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. The shelf life of lyophilized formulations is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
carS; PYRAB16220; PAB1285; CDP-archaeol synthase; CDP-2,3-bis-(O-geranylgeranyl-sn-glycerol synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Pyrococcus abyssi (strain GE5 / Orsay)
Target Names
carS
Target Protein Sequence
MNPIFEAFWYILPAYFANSSPVVLGGGTPIDFGKKWRDGRRIFGDGKTWRGFFGGITVGT VVGTIQHLMFPGYYGSLKLAVGVAFLLSLGALVGDLIGSFIKRRLNMPRGYPAVGLDQWG FLISALCFAYPLRTIPTGEVLFLLVVTPVIHWLANVFAYRMKWKNVPW
Uniprot No.

Target Background

Function
Catalyzes the formation of CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol (CDP-archaeol) from 2,3-bis-(O-geranylgeranyl)-sn-glycerol 1-phosphate (DGGGP) and CTP. This reaction constitutes the third ether-bond-formation step in the biosynthesis of archaeal membrane lipids.
Database Links

KEGG: pab:PAB1285

STRING: 272844.PAB1285

Protein Families
CDP-archaeol synthase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Pyrococcus abyssi and why are its proteins significant for research?

Pyrococcus abyssi is a hyperthermophilic archaeon that thrives in deep-sea hydrothermal vents at temperatures up to 100°C. This extremophile has been extensively studied for its physiology, enzymology, and biotechnological applications, as it provides various thermostable proteins including restriction enzymes and other functional proteins . The study of proteins from P. abyssi, including UPF0290 protein PYRAB16220, contributes significantly to our understanding of protein thermostability, archaeal biology, and potential biotechnological applications. The extreme environmental adaptations of these organisms make their proteins valuable models for studying structural and functional characteristics that enable biological activity under harsh conditions .

How is PYRAB16220 related to other characterized proteins in Pyrococcus abyssi?

While specific information about PYRAB16220's relationships is limited in the provided search results, research on P. abyssi proteins shows they often form functional complexes with other proteins. For example, the Q9UZY3 protein (a small tRNA-binding protein) has been shown to interact with the proteasome regulatory complex (proteasome-activating nucleotidase [PAN]) in P. abyssi . This suggests that PYRAB16220 may similarly participate in protein-protein interactions within cellular pathways. Comparative analysis with other P. abyssi proteins demonstrates that many proteins in this organism have evolved unique structural features to maintain function at extreme temperatures while potentially sharing conserved domains with proteins across archaeal species .

What are the typical structural characteristics of proteins from Pyrococcus abyssi?

Proteins from P. abyssi commonly exhibit structural adaptations for hyperthermostability. Based on findings from similar P. abyssi proteins, these typically include:

  • Compact β-barrel core structures

  • Oligonucleotide/oligosaccharide-binding (OB) folds (as seen in the Q9UZY3 protein)

  • Higher proportion of hydrophobic amino acids in the core

  • Increased number of salt bridges and disulfide bonds

For example, crystallographic studies of the Q9UZY3 protein revealed a monomeric structure with a β-barrel core featuring an OB-fold, which is typically found in translation elongation factors . These structural characteristics contribute to the remarkable thermostability observed in proteins from this hyperthermophilic organism.

What are the optimal methods for cloning and expressing recombinant Pyrococcus abyssi proteins?

Based on successful approaches with other P. abyssi proteins, the recommended methodology includes:

  • Gene Amplification: PCR amplification of the target gene from P. abyssi genomic DNA using synthetic oligodeoxyribonucleotide primers designed to introduce appropriate restriction sites (such as SacI, HindIII, or NdeI and NotI) flanking the open reading frame .

  • Vector Selection: Utilizing expression vectors such as pBAD30 (with arabinose-inducible promoter) or pET28a(+) (with IPTG-inducible promoter) that allow for the addition of affinity tags (e.g., 6-His tag) .

  • Host Strain Selection: E. coli strain JM109 (recA1 endA1 gyrA96 thi hsdR17 e14 supE44 relA1 Δ(lac-proAB)/[F′ traD36 proAB+ lacIq lacZΔM15]) for initial cloning and BL21(DE3) for protein expression .

  • Expression Conditions: Induction with appropriate inducer (IPTG at 1mM final concentration) followed by overnight incubation at lower temperatures (20°C) to enhance proper folding .

  • Cell Harvesting: Centrifugation at 3000× g for 15 minutes followed by resuspension in an appropriate buffer (such as 50 mM Tris–HCl, pH 8.0, 150 mM KCl, 150 mM NaCl, 10 mM MgCl2, 10% glycerol) .

This methodology has proven effective for the expression of functional P. abyssi proteins in heterologous systems.

What purification strategies are most effective for thermostable proteins from Pyrococcus abyssi?

The exceptional thermostability of P. abyssi proteins enables a simplified purification strategy:

  • Heat Treatment: Incubating cell lysate at 80°C for 10 minutes, which denatures most E. coli proteins while leaving the thermostable target protein intact .

  • Affinity Chromatography: Utilizing the introduced affinity tag (typically His-tag) for purification via nickel or cobalt affinity columns.

  • Buffer Optimization: Including appropriate salt concentrations (200-500 mM NaCl) and slightly acidic pH conditions, as observed with M.PabI which showed optimal activity under these conditions .

  • Metal Ion Considerations: Avoiding Zn²⁺ in buffers, as it has been shown to inhibit some P. abyssi proteins (such as M.PabI), while Mg²⁺, Ca²⁺, or Mn²⁺ generally do not cause inhibition .

This heat-based purification approach takes advantage of the inherent thermostability of P. abyssi proteins, providing a significant purification step before conventional chromatographic methods.

How can the thermostability of PYRAB16220 be accurately measured and characterized?

Based on methodologies used for other P. abyssi proteins, the following approaches are recommended:

  • Thermal Activity Assays: Measuring enzymatic activity at various temperatures (ranging from 37°C to 100°C) to determine temperature optima and activity retention.

  • Thermodynamic Parameter Determination: Utilizing the Arrhenius equation to calculate activation energy and other thermodynamic parameters from activity measurements at different temperatures, as was done with M.PabI .

  • Structural Stability Assessment: Employing circular dichroism (CD) spectroscopy to monitor structural changes at increasing temperatures.

  • Differential Scanning Calorimetry (DSC): To determine the melting temperature (Tm) and enthalpy of unfolding.

  • Activity Retention Assays: Testing for retention of function after exposure to high temperatures (e.g., 95°C) for extended periods, similar to tests demonstrating that M.PabI retained at least half its activity after 9 minutes at 95°C .

These approaches provide comprehensive data on thermostability characteristics critical for understanding the structural and functional properties of hyperthermophilic proteins.

How do the functional domains of PYRAB16220 contribute to its thermostability and activity?

Analysis of domain architecture in P. abyssi proteins reveals several mechanisms contributing to thermostability:

  • OB-fold Domains: In proteins like Q9UZY3, the β-barrel core structure with an oligonucleotide/oligosaccharide-binding (OB) fold provides structural stability at high temperatures while maintaining functional interactions with nucleic acids .

  • Disordered Regions: The significance of disordered regions varies; for instance, the N-terminal region of Q9UZY3, predicted to be disordered, was found not essential for complex formation with its protein partner (PAN), suggesting functional independence of certain domains .

  • Conserved Motifs: Analysis of sequence conservation across archaeal species can identify critical motifs for function versus regions that contribute primarily to thermostability.

What protein-protein interaction networks involve PYRAB16220 in Pyrococcus abyssi?

Based on methodologies used to study other P. abyssi proteins, the following approaches can uncover protein-protein interactions:

  • Native Pull-down Experiments: This approach successfully identified Q9UZY3 using the proteasome regulatory complex as bait .

  • Co-immunoprecipitation Studies: This technique confirmed interactions between Q9UZY3 and PAN proteins, demonstrating conservation of interactions across Pyrococcus species .

  • Isothermal Titration Calorimetry (ITC): This method provides quantitative measurements of binding affinities and thermodynamic parameters for protein-protein interactions .

  • Cross-species Conservation Analysis: Comparing interactions across related species (like P. horikoshii and P. abyssi) can reveal evolutionarily conserved interaction networks .

The discovery that Q9UZY3 specifically binds to one PAN homolog (PhPAN2) but not another (PhPAN1) illustrates the specificity of protein-protein interactions in these organisms and highlights the importance of examining multiple potential interaction partners .

How does horizontal gene transfer influence the evolution of proteins like PYRAB16220 in archaeal genomes?

Genome sequence comparisons among multiple Pyrococcus species have revealed significant insights into horizontal gene transfer (HGT) events:

  • Genomic Islands: Comparative genomics between P. abyssi and P. horikoshii demonstrated that many cases of large genomic polymorphisms are tightly linked with putative restriction-modification (RM) genes .

  • GC Content and Codon Usage Analysis: The PabI RM system in P. abyssi appears to have been inserted relatively recently, as evidenced by lower GC content and biased codon usage compared to the bulk of the genome .

  • Sequence Homology with Distant Species: The pabIM gene shows sequence homology with hindIIM and other eubacterial modification genes, suggesting horizontal transfer from distantly related prokaryotes .

These findings suggest that HGT is a significant mechanism for acquiring new functional capacities in archaeal genomes. Similar analyses could reveal whether PYRAB16220 originated through vertical inheritance or horizontal acquisition from other species.

How can researchers troubleshoot expression issues with recombinant hyperthermophilic proteins?

When facing challenges with recombinant expression of hyperthermophilic proteins like those from P. abyssi, consider the following strategies:

  • Codon Optimization: Adapt the gene sequence to the codon usage preferences of the expression host (E. coli) to enhance translation efficiency.

  • Expression Temperature Adjustment: Lower the expression temperature to 20°C after induction to reduce aggregation and improve proper folding .

  • Solubility Enhancement: Incorporate solubility-enhancing fusion tags such as MBP (maltose-binding protein) or SUMO in addition to affinity tags.

  • Buffer Optimization: For P. abyssi proteins, including higher salt concentrations (200-500 mM NaCl) can improve stability and solubility .

  • Alternative Host Systems: Consider archaeal expression systems or thermophilic bacterial hosts that may provide a more compatible cellular environment for proper folding.

  • Protein Engineering: Targeted mutagenesis of surface residues or flexible regions while preserving core structural elements can improve expression without compromising function.

What strategies can resolve protein aggregation issues during purification of thermostable proteins?

When working with thermostable proteins from P. abyssi that show aggregation tendencies:

  • Detergent Supplementation: Low concentrations of mild detergents (0.05% Tween-20 or 0.1% Triton X-100) can reduce hydrophobic interactions that lead to aggregation.

  • Arginine Addition: Including L-arginine (50-200 mM) in purification buffers can suppress aggregation of thermostable proteins.

  • Protein Truncation: If specific regions promote aggregation, constructing truncated versions (as demonstrated with PAN proteins) can improve solubility while maintaining core functions.

  • Ortholog Substitution: When facing persistent aggregation issues with a specific protein (like PaPAN1), using an ortholog from a related species (like P. horikoshii) can be an effective alternative strategy .

  • Strategic Heat Treatment: Controlled heat treatment protocols that gradually increase temperature can help the protein achieve proper folding rather than aggregation.

An empirical approach testing multiple conditions is often necessary to optimize purification protocols for these challenging proteins.

How can the nucleic acid-binding properties of archaeal proteins be leveraged in biotechnology applications?

The nucleic acid binding characteristics of P. abyssi proteins offer several biotechnological opportunities:

  • Thermostable PCR Enhancers: Proteins with single-stranded DNA binding capacity could improve PCR efficiency at high temperatures.

  • RNA Chaperones for RT-PCR: tRNA-binding proteins like Q9UZY3 could potentially enhance reverse transcription reactions at elevated temperatures.

  • DNA Methyltransferases for Epigenetic Studies: M.PabI generates 5′-GTm6AC on double-stranded DNA, providing tools for site-specific DNA methylation studies .

  • DNA Protection in Extreme Conditions: Proteins that bind and stabilize DNA can protect genetic material during exposure to extreme conditions.

  • Nucleic Acid Purification Technologies: Engineered versions of archaeal nucleic acid-binding proteins could serve as affinity ligands in purification systems designed for harsh conditions.

The exceptional stability of these proteins at high temperatures makes them particularly valuable for applications requiring thermal cycling or harsh environmental conditions.

What computational approaches can predict structure-function relationships in hyperthermophilic proteins?

Advanced computational methods for analyzing hyperthermophilic proteins include:

These computational approaches complement experimental methods and can guide rational protein engineering efforts to enhance thermostability or adapt function.

Based on current knowledge of P. abyssi proteins, the following research directions hold significant promise:

  • Structural Biology: Determining high-resolution structures of PYRAB16220 using X-ray crystallography or cryo-electron microscopy to understand its thermostability mechanisms.

  • Functional Genomics: Investigating the role of PYRAB16220 in cellular processes through gene knockout or silencing techniques adapted for archaeal systems.

  • Protein Evolution Studies: Analyzing the evolutionary history of UPF0290 family proteins across archaeal lineages to understand adaptation to different thermal environments.

  • Enzyme Engineering: Developing chimeric proteins combining thermostable domains from P. abyssi proteins with functional domains from mesophilic counterparts to create novel biocatalysts.

  • Systems Biology Approaches: Integrating proteomics, transcriptomics, and metabolomics data to place PYRAB16220 within the broader cellular network context of P. abyssi.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.