Recombinant Pyrococcus furiosus Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cobalamin Biosynthesis

Cobalamin synthase (cobS) catalyzes a key step in the cobalamin biosynthesis pathway, specifically in the conversion of precursors into the final vitamin B12 structure. While the exact biochemical mechanism of P. furiosus cobS is not fully elucidated, its role aligns with the general function of archaeal cobS enzymes, which often involve:

  1. Cobalt Chelation: Coordination of cobalt ions into the corrin ring.

  2. Side-Chain Modifications: Addition of methyl or adenosyl groups to the cobalamin nucleus.

Cobalamin Biosynthesis Pathway

The pathway involves multiple enzymatic steps, with cobS operating in the later stages. Unlike bacterial systems, archaeal pathways may differ in cofactor utilization or intermediate processing .

Cloning and Expression

The recombinant production of cobS employs ligase-independent cloning (LIC) techniques optimized for P. furiosus proteins :

StepMethodologyOutcome
Gene AmplificationPCR with phosphorothioate-modified primers to generate sticky ends.3′ overhangs for vector compatibility
Vector PreparationpDEST17 plasmid amplified with phosphorothioate primers and digested with λ exonuclease.Linear vector with complementary overhangs
Cloning Efficiency≥80% positive clones in 96-well plate format.High-throughput library construction
Expression HostE. coli Rosetta 2(DE3)pLysS (to support disulfide bond formation).~70% expression success rate

Key Challenges:

  • Frameshift Mutations: ~12% error rate in PCR primers, causing non-functional clones .

  • Optimization: Protease K treatment improves exonuclease digestion efficiency by degrading residual PCR enzymes .

Biochemical and Biophysical Properties

PropertyValue/DescriptionSource
Molecular Weight~26 kDa (estimated from 228 aa)
PurificationAffinity chromatography via His tag. ,
Storage BufferTris-based buffer with 50% glycerol, optimized for stability.
Storage Temperature-20°C (avoid repeated freeze-thaw cycles)

Thermostability

While direct thermodynamic data for cobS is unavailable, P. furiosus proteins are typically stable above 90°C due to their hyperthermophilic origin . This property makes cobS attractive for high-temperature industrial processes.

Industrial Applications

  1. Vitamin B12 Production: Cobalamin synthesis for dietary supplements or livestock feed.

  2. Biocatalysis: Utilization in enzymatic cascades requiring thermostable catalysts.

Research Tools

  • Structural Biology: Crystallization studies to elucidate archaeal cobalamin synthase mechanisms.

  • Enzyme Engineering: Mutagenesis to enhance substrate specificity or catalytic efficiency.

Challenges and Considerations

  1. Low Expression Yield: ~30% of P. furiosus proteins fail to express in E. coli due to codon bias or chaperone requirements .

  2. Post-Translational Modifications: Potential need for archaeal-specific folding systems.

  3. Regulatory Complexity: Cobalamin biosynthesis involves multiple enzymes; cobS requires co-expression with auxiliary proteins for full activity.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate special requirements for the format. Please specify your preferred format in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference for your own adjustments.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; PF0299; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Target Names
cobS
Target Protein Sequence
MKNLIQFMTRVPIKGDFEKAREEVWMLPLLTPLTAFIPSLILYLNIPLKNVLSILSLYWV IGLLHLDGLADWADGIMVKGDREKKVRAMKDVNTGIAGTFAVVMILLIQVYSLFSAPFYS IYLAELNSKMAMLLALATKKPLGEGLGKYFMDKLTTKRVFLGGVLYALLLIPILLYDPQS IFALLGLVGGIYAVKISLDNFGGLNGDCIGAVGEITRGATLLILGVWA
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) from *Pyrococcus furiosus* catalyzes the synthesis of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links

KEGG: pfu:PF0299

STRING: 186497.PF0299

Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Pyrococcus furiosus Cobalamin synthase (cobS) and what is its function?

Cobalamin synthase (cobS) from Pyrococcus furiosus is an enzyme involved in the biosynthesis of vitamin B12 (cobalamin). The protein is encoded by the cobS gene (locus name PF0299) and functions as a key enzyme in the assembly of the corrin ring structure of cobalamin . It catalyzes one of the final steps in cobalamin biosynthesis, specifically the attachment of the nucleotide loop to the corrin ring. The enzyme is officially designated with the Enzyme Commission (EC) number 2.-.-.- indicating that its precise catalytic mechanism is still being characterized .

The full-length protein consists of 228 amino acids, and the complete amino acid sequence is available: MKNLIQFMTRVPIKGDFEKAREEVEMLPLLTPLTAFIPSLILYLNIPLKNVLSILSLYWVIGLLHLDGLADWADGIMVKGDREKKVRAMKDVNTGIAGTFAVVMILLIQVYSLFSAPFYSIYLAEINSKMAMLLALATKPLGEGLGKYFMDKLTTRVFLGGVLYALLLIPILYPDQSIFALLGLVGGIYAVKISLDNFGGLNGDCIGAVGEITRGATLLILGVWA .

What are the structural characteristics of cobS that influence its functionality?

The cobS enzyme possesses several structural characteristics that significantly influence its functionality:

  • Membrane association: CobS appears to be an integral membrane protein, which explains why its activity increases substantially when inserted into a lipid bilayer . Studies have demonstrated that the enzyme shows significantly higher activity when reconstituted in proteoliposomes compared to detergent-solubilized preparations .

  • Hydrophobic domains: Analysis of the protein sequence reveals multiple hydrophobic regions that likely form transmembrane helices, facilitating its insertion into membranes . These domains are critical for maintaining the proper protein conformation required for catalytic activity.

  • Active site architecture: While the detailed three-dimensional structure of P. furiosus cobS has not been fully characterized in the provided search results, functional studies suggest that the enzyme possesses a catalytic domain capable of interacting with both the corrin ring intermediate and nucleotide substrate .

  • Thermostability: Being derived from the hyperthermophilic archaeon P. furiosus, the enzyme exhibits remarkable stability at high temperatures, making it valuable for biochemical studies requiring extreme conditions .

What are the optimal expression systems for recombinant P. furiosus cobS protein?

The recombinant P. furiosus cobS protein has been successfully expressed in Escherichia coli expression systems . When expressing this membrane protein, several factors should be considered:

  • Expression vector selection: Vectors containing strong promoters (like T7) with appropriate fusion tags (commonly His-tags for simplified purification) have proven effective . The full-length protein (amino acids 1-228) can be expressed with an N-terminal His-tag to facilitate purification .

  • Host strain considerations: E. coli strains optimized for membrane protein expression (such as C41(DE3) or C43(DE3)) often yield better results than standard laboratory strains due to their ability to accommodate membrane protein overexpression.

  • Induction conditions: Lowering the induction temperature (typically to 16-20°C) and using reduced concentrations of inducers can improve the proper folding and membrane insertion of cobS, decreasing the formation of inclusion bodies.

  • Co-expression strategies: In some cases, co-expressing chaperones or fusion partners that enhance membrane protein folding and stability can improve the yield of functional protein.

For researchers requiring pre-made recombinant protein, commercially produced full-length P. furiosus cobS fused to an N-terminal His-tag is available .

What purification strategies are most effective for obtaining active cobS enzyme?

Purification of membrane proteins like cobS presents unique challenges. Based on the available literature, an effective purification strategy involves:

  • Membrane fraction isolation: After cell lysis, differential centrifugation is used to isolate the membrane fraction containing the cobS protein .

  • Solubilization: Careful selection of detergents is critical. According to the search results, attempts to solubilize cobS with detergents like Nonidet P-40, Brij35, CHAPS, LDAO, and n-tetradecyl-N-N-dimethylglycine were unsuccessful . Instead, phospholipid solubilization combined with affinity purification has been reported to increase both yield and purity .

  • Affinity chromatography: Using the His-tag, immobilized metal affinity chromatography (IMAC) can be employed to purify the protein . This approach, when optimized, can yield protein with approximately 96% homogeneity and a yield of about 0.5 mg of protein per gram of cells (wet weight) .

  • Reconstitution into liposomes: For functional studies, reconstituting the purified cobS into liposomes significantly enhances its enzymatic activity . This step is crucial as the protein shows substantially higher activity in a lipid environment compared to detergent-solubilized forms.

  • Storage conditions: The purified protein is typically stored in a Tris-based buffer containing 50% glycerol at -20°C or -80°C for extended storage . It's recommended to avoid repeated freezing and thawing cycles, and working aliquots can be stored at 4°C for up to one week .

How can researchers measure the enzymatic activity of cobS in vitro?

Measuring the enzymatic activity of cobS requires specialized techniques due to its membrane association and the complexity of its reaction. Based on the search results, researchers have employed several approaches:

  • Bioassay-based methods: Activity can be detected using a bioassay where growth of a cobS-deficient bacterial strain in an agar overlay is dependent on the product of the CobS reaction . This method confirms that the enzyme is functional, particularly when reconstituted in proteoliposomes .

  • Direct activity measurements: Specific activity of cobS can be quantified by measuring the conversion of substrates to products. For solubilized cobS and cobS proteoliposomes, activities of approximately 68 and 550 pmol min⁻¹mg⁻¹ of protein, respectively, have been reported . This dramatic difference (approximately 8-fold higher activity in proteoliposomes) underscores the importance of the lipid environment for proper enzyme function.

  • HPLC confirmation: Reverse-phase high-pressure liquid chromatography (HPLC) can be used to confirm reaction products, using authentic cobalamin 5'-P as a positive control . This allows for both qualitative and quantitative analysis of the enzyme's activity.

  • Spectroscopic methods: While not explicitly mentioned in the search results, spectroscopic techniques monitoring either substrate consumption or product formation can potentially be used to assess cobS activity in real-time.

What factors affect the activity of recombinant cobS and how can these be optimized for experimental purposes?

Several factors significantly influence the activity of recombinant cobS:

  • Lipid environment: The most dramatic effect on cobS activity comes from its reconstitution into a lipid bilayer. Activity increases approximately 8-fold when the enzyme is embedded in proteoliposomes compared to detergent-solubilized forms . Researchers should consider optimizing:

    • Lipid composition

    • Protein-to-lipid ratio

    • Reconstitution method

  • Buffer conditions: The enzyme likely requires specific pH, salt concentration, and potentially metal cofactors for optimal activity. While specific optimal conditions aren't detailed in the search results, researchers should systematically test:

    • pH range (likely alkaline, based on related enzymes)

    • Salt concentration (consider that P. furiosus is hyperthermophilic)

    • Divalent metal ions (particularly cobalt, given its role in cobalamin chemistry)

  • Temperature: As P. furiosus is hyperthermophilic (growing optimally around 100°C), the enzyme likely exhibits higher activity at elevated temperatures. Assays should be conducted at temperatures that balance enzyme stability, substrate stability, and activity.

  • Substrate concentration: Optimizing substrate concentrations based on the enzyme's kinetic parameters (Km, Vmax) will ensure maximum activity while avoiding potential substrate inhibition.

  • Storage conditions: Activity can be preserved by storing the enzyme at -20°C or -80°C in a Tris-based buffer with 50% glycerol . Working aliquots should be kept at 4°C for no more than one week, and repeated freeze-thaw cycles should be avoided .

What genetic systems are available for studying cobS function in P. furiosus?

Pyrococcus furiosus has developed into a genetically tractable organism with several tools available for studying genes like cobS:

  • Competent strain: P. furiosus strain COM1 has been isolated and characterized as naturally and efficiently competent for DNA uptake, unlike the wild-type strain . This strain, and derivatives like GLW101 (COM1 ΔpyrF), greatly facilitate genetic manipulation by allowing efficient transformation without chemical or physical treatments .

  • Homologous recombination: The COM1 strain demonstrates remarkably efficient homologous recombination. While 1,000 bp of homology provides the highest efficiency (approximately 10³ transformants per μg of DNA), recombination can occur with flanking regions as short as 20-40 nucleotides . This ability enables efficient marker replacement using linear DNA via direct selection .

  • Marker systems: Several selectable markers are available for P. furiosus genetic manipulation:

    • The pyrF gene (encoding orotidine-5'-phosphate decarboxylase) can be used for both positive selection (uracil prototrophy) and negative selection (5-fluoroorotic acid resistance)

    • The trpAB locus has been used to generate tryptophan auxotrophs, providing an additional selectable marker

  • Markerless deletion method: A strategy has been developed for generating markerless deletions in P. furiosus using a two-step process: first, marker replacement using PCR products, followed by marker excision or "pop-out" . This approach allows direct selection of targeted mutants and subsequent removal of the selectable marker.

How do cobS knockout studies contribute to understanding cobalamin metabolism in archaea?

Knockout studies of cobS and related genes provide valuable insights into cobalamin metabolism in archaea:

  • Transport vs. synthesis: Studies in Halobacterium sp. strain NRC-1 (another archaeon) revealed that mutations in cobalamin transport genes (btuC, btuD, btuF orthologs) resulted in strains requiring 10⁵-fold higher concentrations of cobalamin for growth compared to wild-type . This demonstrates the critical importance of cobalamin uptake systems in archaea and suggests potential interactions between transport and biosynthetic pathways that might include cobS.

  • Metabolic dependencies: Cobalamin is essential for propanediol metabolism in many organisms . Knockout studies help elucidate the relationship between cobalamin biosynthesis (including cobS function) and dependent metabolic pathways.

  • Regulatory networks: Research on regulatory networks in H. salinarum suggests a feed-forward gene regulatory topology for cobalamin biosynthesis . Similar studies in P. furiosus could reveal whether cobS is part of comparable regulatory networks and how its expression responds to environmental conditions.

  • Evolutionary insights: Comparative analysis of cobS mutants across different archaeal species can provide information about the evolution of vitamin B12 biosynthesis pathways and potential differences between archaeal and bacterial systems.

How is recombinant P. furiosus cobS utilized in biochemical and structural studies?

Recombinant P. furiosus cobS serves multiple research purposes in biochemical and structural investigations:

  • Mechanistic studies: The purified enzyme enables detailed investigation of the catalytic mechanism of cobalamin biosynthesis. The improved purification protocol yielding 96% homogeneous protein facilitates such studies . Researchers can use the purified enzyme to:

    • Determine precise reaction kinetics

    • Identify essential catalytic residues

    • Elucidate the complete reaction mechanism

  • Membrane protein research: As a membrane protein from a hyperthermophilic archaeon, cobS provides a valuable model system for studying:

    • Membrane protein folding and stability at extreme temperatures

    • Lipid-protein interactions in membrane enzymes

    • Structural adaptations of membrane proteins in thermophiles

  • Structural biology: While not explicitly mentioned in the search results, the availability of purified recombinant cobS facilitates structural studies using techniques like:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy

    • NMR spectroscopy (for specific domains)

    • Small-angle X-ray scattering (SAXS)

  • Biotechnological applications: The thermostable nature of P. furiosus cobS makes it potentially useful for biotechnological applications requiring stability at high temperatures or in harsh conditions.

What are the challenges and future directions in P. furiosus cobS research?

Despite significant progress, several challenges and promising future directions exist in P. furiosus cobS research:

  • Structural determination: Obtaining a high-resolution structure of this membrane-embedded enzyme remains challenging but would provide invaluable insights into its mechanism and evolution.

  • Complete characterization of the reaction: While the general function of cobS is known, detailed characterization of substrates, intermediates, and products would enhance understanding of the complete reaction cycle.

  • Regulatory networks: Investigation of how cobS expression is regulated in P. furiosus in response to environmental conditions (particularly metal availability) represents an important research direction. Studies in other organisms suggest complex regulatory systems for cobalamin biosynthesis , and similar networks may exist in P. furiosus.

  • Protein-protein interactions: Identifying potential interaction partners of cobS within the cobalamin biosynthetic pathway could reveal higher-order complexes or metabolic channeling mechanisms.

  • Comparative enzymology: Comparing the properties of cobS from P. furiosus with homologs from bacteria and other archaea could provide evolutionary insights and potentially reveal archaeal-specific adaptations in cobalamin biosynthesis.

  • Application in synthetic biology: The thermostable nature of P. furiosus cobS could make it valuable for synthetic biology applications, particularly for developing thermostable biosynthetic pathways for vitamin B12 production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.