Recombinant Pyrococcus furiosus Molybdate/tungstate transport system permease protein wtpB (wtpB)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

WtpB has been successfully expressed in Escherichia coli for biochemical studies:

Table 1: Recombinant Expression Parameters

ParameterSpecification
Expression HostE. coli BL21-CodonPlus(DE3)-RIL or Rosetta 2(DE3)pLysS
VectorpASK-IBA2 (with N-terminal OmpA signal peptide)
TagC-terminal Strep-tag or His-tag
Yield~5 mg/L culture (small-scale)
Purity>90% (confirmed by SDS-PAGE)
StorageTris buffer with 50% glycerol at -20°C or -80°C

Cloning strategies exclude the native leader sequence to enhance solubility, leveraging E. coli’s OmpA secretion system for periplasmic localization .

Functional Role in Tungstate/Molybdate Transport

WtpB operates as the permease subunit in the WtpABC transporter, which exhibits:

  • Substrate Specificity: Binds both WO₄²⁻ (K<sub>D</sub> = 17 pM) and MoO₄²⁻ (K<sub>D</sub> = 11 nM) via WtpA, the solute-binding protein .

  • Selectivity Mechanism: Despite environmental MoO₄²⁻ excess, P. furiosus preferentially imports WO₄²⁻ due to WtpA’s 1,000-fold higher affinity for tungstate .

  • Genomic Context: The wtpABC operon is conserved in archaea lacking ModA/TupA systems, suggesting evolutionary specialization for high-temperature metal uptake .

Applications and Research Utility

Recombinant WtpB is utilized in:

  • Structural Biology: Membrane protein folding studies under thermophilic conditions .

  • Biotechnological Engineering: Development of tungsten-selective biosensors or bioextraction systems .

  • Comparative Genomics: Investigating archaeal metal transport evolution .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.

Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability.

Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.

Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

The specific tag will be determined during production. To prioritize a specific tag, please inform us during the ordering process.

Synonyms
wtpB; PF0081; Molybdate/tungstate transport system permease protein WtpB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Target Names
wtpB
Target Protein Sequence
MDRRDYLAYAFAGLGAFLVAFIGLPLFMIFIKQAYDLEALQRTLVDPLVIESIRNSLFTA TVSTLLGILFGVPLGYVLARKEFKGKNFVQALIDTPIVIPHSVVGIMLLVTFSDAILDNY KGIVAVMLFVSSPFIVNSARDGFLSVDEKLEYVARTLGASGLRTFFSVTLPNAIHSIASG AIMAWARAISEVGAILIVAYYPKTAQVLIMEYFNNYGLRASRPIAVILVTISLAVFIFLR WLVGRGRNA
Uniprot No.

Target Background

Function

The recombinant Pyrococcus furiosus molybdate/tungstate transport system permease protein wtpB (wtpB) is a component of the ABC transporter complex WtpABC. It is believed to facilitate the transmembrane translocation of molybdate/tungstate substrates.

Database Links

KEGG: pfu:PF0081

STRING: 186497.PF0081

Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of WtpB in Pyrococcus furiosus?

WtpB functions as the membrane permease component of the tungstate/molybdate ABC transporter system in Pyrococcus furiosus. As part of this system (which includes WtpA, the periplasmic binding protein), WtpB forms a transmembrane channel that facilitates the movement of tungstate and molybdate oxoanions across the cell membrane . The protein is encoded within an operon containing PF0080 (WtpA), PF0081, and PF0082 genes, which together constitute a complete tungstate-selective ABC transporter . This system is critical for P. furiosus as the organism's growth is fully dependent on tungsten availability in the medium .

How does WtpB relate to other components of the ABC transporter system?

WtpB works in concert with other proteins in the tungstate/molybdate ABC transporter system. The complete system typically consists of:

  • WtpA (PF0080): The periplasmic binding protein that captures tungstate/molybdate with extremely high affinity (KD of 17 ± 7 pM for tungstate)

  • WtpB: The membrane permease protein forming the transmembrane channel

  • ATP-binding protein: Provides energy for active transport through ATP hydrolysis

This transport system is distinct from previously characterized ModA (for molybdate) and TupA (for tungstate) systems, and represents a novel mechanism for tungstate and molybdate acquisition in archaea and some bacteria .

What are the recommended methods for cloning and expressing recombinant WtpB?

For successful expression of recombinant WtpB, researchers should consider the following methodological approach based on techniques applied to related proteins in the same transport system:

  • Gene amplification: Amplify the WtpB gene using PCR with high-fidelity polymerase (such as Pfx polymerase) and specific primers containing appropriate restriction sites .

  • Vector selection: Choose an expression vector with features suitable for membrane proteins. For WtpA, the pASK-IBA2 vector was successful, and a similar strategy may work for WtpB .

  • Leader sequence considerations: Unlike WtpA, which was cloned without its native leader sequence and instead used an E. coli OmpA leader peptide, WtpB as a membrane protein requires careful consideration of transmembrane domains and topology .

  • Expression conditions: Express in E. coli under controlled conditions, potentially using lower temperatures (25-30°C) to facilitate proper membrane protein folding.

  • Purification approach: Utilize affinity tags such as Strep-tag for purification, with protocols optimized for membrane proteins including appropriate detergents for solubilization.

When expressing WtpB, researchers should be aware that as a membrane protein, yields may be significantly lower than those observed for the soluble WtpA protein (~5 mg per liter of induced E. coli culture) .

What challenges are associated with purifying membrane permease proteins like WtpB?

Purifying membrane permeases like WtpB presents several technical challenges:

  • Protein solubilization: Requires careful selection of detergents to extract WtpB from the membrane while maintaining protein structure and function

  • Protein stability: Membrane proteins often have reduced stability when removed from their native lipid environment

  • Protein aggregation: Risk of aggregation during concentration steps

  • Functional assessment: Difficulty in assessing functional activity outside the complete transporter complex

Successful approaches often combine mild detergents (such as DDM or LMNG) with lipid-like molecules for stabilization. Purification should be performed at 4°C with protease inhibitors to minimize degradation. For hyperthermophilic proteins like those from P. furiosus, heat treatment steps may actually increase purity while reducing contamination from E. coli proteins.

How can researchers determine the structural characteristics of WtpB?

Researchers can employ the following methods to elucidate WtpB structure:

  • Bioinformatic analysis: Predict transmembrane domains, topology, and structural motifs through computational tools and homology modeling

  • Membrane protein crystallization: Utilize specialized techniques such as lipidic cubic phase crystallization or detergent screening to obtain crystals for X-ray diffraction studies

  • Cryo-electron microscopy: Increasingly the method of choice for membrane proteins, potentially revealing WtpB structure within the context of the complete transporter

  • Crosslinking studies: Identify interaction interfaces between WtpB and other transporter components

  • Cysteine scanning mutagenesis: Systematically replace residues with cysteine to probe accessibility and identify critical regions

  • Limited proteolysis: Identify stable domains and flexible regions

These approaches should be combined for a comprehensive structural understanding of WtpB and its position within the tungstate/molybdate transport system.

What experimental approaches can assess tungstate versus molybdate selectivity through the WtpB channel?

To investigate selectivity of the WtpB channel component, researchers can utilize these approaches:

  • Site-directed mutagenesis: Create mutations in predicted selectivity-determining residues and assess transport efficiency

  • Reconstitution in liposomes: Incorporate purified WtpB (along with other transporter components) into liposomes and measure transport of radiolabeled tungstate versus molybdate

  • Electrophysiology: If feasible, patch-clamp studies of reconstituted transporters to measure ion conductance with different substrates

  • Binding studies with tungstate/molybdate analogs: Use structural analogs to probe the specificity determinants

  • In vivo transport assays: Create complementation systems in model organisms lacking native transport systems

How does temperature affect WtpB structure and function in the hyperthermophilic context?

P. furiosus grows optimally at 100°C, making the thermal stability of its proteins, including WtpB, a fascinating area of study . Research approaches to investigate thermal effects include:

  • Comparative structural analysis: Compare WtpB with mesophilic homologs to identify stabilizing features

  • Thermal stability assays: Monitor protein unfolding at different temperatures using methods like circular dichroism or differential scanning calorimetry

  • Molecular dynamics simulations: Model WtpB behavior at different temperatures

  • Functional assays at varying temperatures: Reconstitute the transport system and assess activity across a temperature range

  • Analysis of lipid interactions: Investigate how hyperthermophilic membrane composition affects WtpB stability and function

The exceptional thermal stability of P. furiosus proteins likely applies to WtpB as well, potentially involving features such as increased hydrophobic interactions, additional salt bridges, compact packing, and reduced flexible loops compared to mesophilic counterparts.

What is the relationship between tungsten/molybdenum availability and WtpB expression?

The regulation of WtpB expression in response to metal availability represents a complex adaptive mechanism in P. furiosus. Research indicates:

  • The tungstate/molybdate ABC transporter expression appears to be regulated by metal availability, with evidence of tungstate-dependent negative feedback on the expression of the transporter

  • P. furiosus demonstrates a clear preference for tungsten over molybdenum incorporation in its enzymes, even when intracellular concentrations of both metals are comparable

  • A selective intracellular mechanism must exist for preferential processing of tungstate over molybdate

To investigate this regulatory system, researchers could:

  • Perform quantitative PCR to measure WtpB transcript levels under varying metal conditions

  • Use reporter gene constructs to monitor promoter activity

  • Conduct proteomics analysis to quantify WtpB expression under different metal regimes

  • Identify potential regulatory proteins through pull-down assays and genetic screens

How should researchers design experiments to study WtpB function within the complete ABC transporter complex?

Effective experimental design for studying WtpB within its functional complex should consider:

  • Co-expression strategies: Express all components of the ABC transporter (WtpA, WtpB, and ATP-binding protein) simultaneously with compatible tags for co-purification

  • Reconstitution approaches: Establish protocols for reconstituting the complete complex in liposomes or nanodiscs to allow functional studies

  • In vivo complementation systems: Develop knockout/complementation systems in model organisms to test function

  • Interaction studies: Employ techniques like FRET, crosslinking, or co-immunoprecipitation to confirm proper complex assembly

  • Substrate transport assays: Develop assays measuring tungstate/molybdate transport using radioactive tracers or fluorescent analogs

The table below outlines key experimental approaches for studying the complete transporter:

Experimental ApproachTechniquePrimary Information GainedConsiderations
Complex assemblyBlue-native PAGENative complex formationDetergent selection critical
Protein-protein interactionsCrosslinking + MSInteraction interfacesRequires careful optimization
Transport kineticsIsotope uptake assaysTransport rates and specificityNeed reconstituted system
Structure determinationCryo-EMComplete complex architectureChallenging for membrane proteins
Conformational changesFRET or EPRDynamic structural changesRequires site-specific labeling

What statistical approaches are recommended for analyzing tungstate/molybdate transport data?

For rigorous analysis of transport data involving WtpB and the complete transporter system, researchers should employ:

  • Enzyme kinetics models: Apply Michaelis-Menten kinetics or more complex models to determine transport parameters (Km, Vmax)

  • Competition assays analysis: When studying substrate selectivity through competition experiments, use appropriate competitive inhibition models

  • Time-series analysis: For uptake kinetics, apply time-series statistical methods

  • Bayesian approaches: Consider Bayesian statistical frameworks for complex datasets with multiple variables

  • Experimental design principles: When designing transport experiments, apply modern decision theoretic optimal experimental design methods to maximize information gain

When comparing wild-type versus mutant WtpB variants, researchers should use appropriate statistical tests (t-tests, ANOVA) with corrections for multiple comparisons. The experimental design should include sufficient biological and technical replicates (typically n≥3) to ensure statistical power.

How do researchers reconcile contradictions regarding metal specificity in the WtpB transport system?

The available data presents interesting contradictions regarding metal specificity that researchers must address:

  • While WtpA has approximately 1000-fold higher affinity for tungstate (KD: 17±7 pM) than molybdate (KD: 11±5 nM), both metals can be transported by the system

  • P. furiosus demonstrates preferential incorporation of tungsten even when intracellular concentrations of tungstate and molybdate are comparable

  • Evidence suggests tungstate-dependent negative feedback on transporter expression

To resolve these contradictions, researchers should:

  • Investigate post-transport metal processing pathways in P. furiosus

  • Examine the role of metallochaperones in directing metals to appropriate targets

  • Study the kinetics of metal transport versus the thermodynamics of binding

  • Consider evolutionary aspects of metal utilization in hyperthermophiles

  • Conduct competition experiments with both metals present simultaneously

Understanding these contradictions requires examining the entire pathway from metal uptake through incorporation into enzymes, rather than focusing on WtpB in isolation.

What methodological approaches can address the challenges of studying low-abundance membrane proteins like WtpB?

WtpB likely presents challenges as a low-abundance membrane protein. Researchers can address these through:

  • Overexpression optimization: Screen multiple expression vectors, host strains, and induction conditions to maximize yield

  • Sensitivity-enhancing detection methods: Employ techniques like Western blotting with enhanced chemiluminescence or fluorescent antibodies

  • Mass spectrometry approaches: Use targeted proteomics (SRM/MRM) for detection and quantification of low-abundance proteins

  • Functional amplification: Develop coupled assays where transport activity produces a signal-amplified readout

  • Single-molecule techniques: Consider single-molecule fluorescence approaches that don't require large protein quantities

For purification of sufficient protein for structural studies, researchers may need to scale up significantly, potentially using large-volume fermentation (50-100L) of recombinant expression strains.

What are the most promising research directions for understanding WtpB's role in extremophile adaptation?

Future research on WtpB should focus on:

  • Comparative genomics: Analyze WtpB homologs across extremophiles to identify adaptive features unique to hyperthermophiles

  • Systems biology approach: Study the integration of metal transport with downstream metabolic pathways requiring tungsten or molybdenum

  • Synthetic biology applications: Engineer modified WtpB variants for biotechnological applications requiring controlled metal transport

  • Evolution of metal specificity: Investigate how tungsten preference evolved in P. furiosus and related organisms

  • Structural basis of thermostability: Determine specific structural features enabling WtpB to function at extreme temperatures

These directions would contribute significantly to our understanding of not only metal transport in extremophiles but also the broader principles of protein adaptation to extreme environments.

How might comprehensive characterization of WtpB contribute to broader understanding of ABC transporters?

Thorough characterization of WtpB would advance ABC transporter research through:

  • Providing insights into the structural basis of thermostability in membrane transporters

  • Elucidating mechanisms of metal selectivity in transport channels

  • Contributing to understanding how membrane proteins adapt to extreme environments

  • Establishing evolutionary relationships between different classes of metal transporters

  • Potentially revealing novel structural or functional features unique to archaeal systems

The tungstate/molybdate transport system in P. furiosus represents an important model for understanding how organisms selectively acquire essential trace metals in extreme environments, with implications for both fundamental biology and potential biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.