Recombinant Pyrococcus furiosus Probable cobalamin biosynthesis protein CobD (cobD)

Shipped with Ice Packs
In Stock

Description

Expression and Purification Methods

Recombinant CobD production involves high-throughput (HTP) cloning and optimized E. coli expression systems:

ParameterDetailsReference
Expression HostE. coli Rosetta 2(DE3)pLysS
VectorpDEST17 (prokaryotic vector with T7 promoter)
Induction0.5 mM IPTG at 37°C for 3 hours
PurificationSDS-PAGE confirmation; potential nickel affinity chromatography (if tagged)

Cloning Efficiency Optimization:

  • Phosphorothioate-Modified Primers: Used to generate 3′ overhangs for λ exonuclease-mediated cloning .

  • Protease K Treatment: Enhances cloning efficiency by degrading residual DNA polymerases .

Enzymatic Activity and Role in Cobalamin Biosynthesis

CobD’s decarboxylase activity is pivotal for generating intermediates in cobalamin synthesis.

SubstrateProductEnzyme ActivityReference
L-threonine-O-3-phosphate(R)-1-amino-propanol O-2-phosphateL-threonine-O-3-phosphate decarboxylase

Pathway Context:

  • CobD operates downstream of cobalamin precursors like uroporphyrinogen III .

  • In Salmonella enterica, archaeal orthologs (e.g., Methanococcus mazei cbiP/cbiB) complement cobalamin biosynthesis defects, highlighting evolutionary conservation .

Research Applications and Findings

  • Proteomics Identification: CobD was identified in P. furiosus soluble extracts via MudPIT (Multidimensional Protein Identification Technology), demonstrating its natural abundance .

  • Recombinant Utility: Used in biochemical assays to study cobalamin biosynthesis kinetics and structural biology .

  • Hyperthermophilic Adaptation: Recombinant CobD retains activity in mesophilic hosts (E. coli), though folding challenges may exist .

Data Tables

Table 1: Cloning Efficiency with Protease K

TreatmentClone Number
Without Protease KLow
With Protease KHigh

Table 2: Proteomics Identification via MudPIT

MethodProteins IdentifiedPeptides IdentifiedSpectra Identified
MudPIT-LTQ1,279 ± 911,004 ± 522105,215 ± 12,210
MudPIT-Orbitrap-ETD1,015 ± 237,548 ± 1,61152,992 ± 10,370

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
cobD; PF0296; Probable cobalamin biosynthesis protein CobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Target Names
cobD
Target Protein Sequence
MDMTLPIALLIDLMFGEPPAIIHPVVGFGKVIEFFDNKYRRRSPYLDFLVGAISSLVVIG LAFILSHLPNFLPNPFNLILSIYLLKSSFAIRSLHDHVKRTITPDLEEKRRAVSMIVSRD TKSLDEPHLNSAAIESLSENINDSVIAPLFYYLIFGLPGAVVYRAVNTLDAMIGYRNEKY EYFGKFAARLDDLLNFVPARITVLLFLSLGGRKVIRYYRMAKYKINSDKPIAAMSAVLGV WLEKPNYYKFPGRRPENEDIKRALKVYWIIVVEFLLIVAIILYGG
Uniprot No.

Target Background

Function
This protein catalyzes the conversion of cobyric acid to cobinamide by adding aminopropanol to the F carboxylic group.
Database Links

KEGG: pfu:PF0296

STRING: 186497.PF0296

Protein Families
CobD/CbiB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Pyrococcus furiosus CobD and what is its primary function?

Pyrococcus furiosus CobD is an enzyme involved in cobalamin (vitamin B12) biosynthesis. It exhibits L-threonine-O-3-phosphate decarboxylase activity and is responsible for the synthesis of (R)-1-amino-propanol O-2- . As part of the archaeal cobalamin biosynthetic pathway, CobD contributes to the unique metabolic capabilities that allow P. furiosus to thrive in extreme environments. This enzyme belongs to a broader network of proteins that facilitate the synthesis and salvaging of cobalamin precursors in archaea through pathways distinct from those found in bacteria .

How does Pyrococcus furiosus' metabolism differ from other organisms?

Pyrococcus furiosus, first described in 1986, exhibits several distinctive metabolic features that differentiate it from other organisms. Unlike many hyperthermophiles, P. furiosus preferentially utilizes sugars (particularly starch) over amino acids for its anaerobic metabolism . Its sugar metabolism differs significantly from classical glycolytic pathways in several key aspects:

  • Sugar kinases in P. furiosus require ADP instead of ATP

  • Glyceraldehyde-3-phosphate oxidation is not coupled to ATP synthesis and requires ferredoxin instead of NAD+

  • Conversion of phosphoenolpyruvate to pyruvate is AMP and PPi dependent, catalyzed by phosphoenolpyruvate synthase

  • Acetyl-CoA conversion to acetate occurs through a one-step reaction without acetyl-P as an intermediate

  • A novel membrane-bound hydrogenase complex (Mbh) composed of 14 proteins is involved in hydrogen production

These unique metabolic features, combined with its extreme thermostability, make P. furiosus and its enzymes (including CobD) valuable subjects for research into archaeal biochemistry and potential biotechnological applications.

What is the relationship between CobD and cobalamin biosynthesis in archaea?

In archaea, CobD functions as part of a distinct pathway for cobalamin biosynthesis that differs from the well-characterized bacterial pathway. Research on archaeal cobalamin biosynthesis has revealed that while many of the core enzymatic functions are conserved between bacteria and archaea, the specific proteins and metabolic routes can differ significantly .

CobD functions in proximity to other key enzymes in the pathway, including CbiP (adenosylcobyric acid synthase) and CbiB (adenosylcobinamide-phosphate synthase). Studies in Halobacterium sp. strain NRC-1 have shown that mutations in cbiP result in adenosylcobyric acid auxotrophy, while cbiB mutants are adenosylcobinamide-GDP auxotrophs . This indicates that CobD functions within a coordinated enzymatic cascade that produces cobalamin in archaea, though its precise position and relationship to other enzymes may differ from bacterial systems.

How does the archaeal cobinamide salvaging pathway differ from the bacterial pathway, and what role might CobD play?

Research with Halobacterium sp. strain NRC-1 suggests that the archaeal pathway involves:

  • An amidohydrolase enzyme that cleaves the aminopropanol moiety of adenosylcobinamide, yielding adenosylcobyric acid

  • Conversion of adenosylcobyric acid to adenosylcobinamide-phosphate by the adenosylcobinamide-phosphate synthase (CbiB)

This pathway difference explains why archaea lack an adenosylcobinamide kinase. While the search results don't explicitly define CobD's role in this alternate pathway, its L-threonine-O-3-phosphate decarboxylase activity suggests it may be involved in generating precursors for the aminopropanol moiety or in other aspects of the modified archaeal cobinamide salvaging mechanism .

What structural and functional adaptations enable CobD to function at extreme temperatures in P. furiosus?

While the search results don't provide specific structural information about CobD, we can infer likely adaptations based on what is known about other P. furiosus enzymes. P. furiosus is a hyperthermophile capable of growing above the boiling point of water, with many of its enzymes exhibiting extreme thermostability .

Typical structural adaptations in P. furiosus enzymes include:

  • Increased number of salt bridges and ionic interactions that strengthen at high temperatures

  • Higher proportion of hydrophobic amino acids in the protein core

  • Reduced number of thermolabile amino acids (e.g., asparagine, glutamine)

  • More compact protein folding with fewer surface loops

  • Increased disulfide bonding

For example, other P. furiosus enzymes like β-glucosidase demonstrate remarkable thermostability with a half-life of 85 hours at 100°C, while an α-amylase maintains a half-life of 2 hours even at 120°C . CobD likely incorporates similar structural features that enable it to maintain its functional conformation and catalytic activity under the extreme conditions of P. furiosus' natural habitat.

How do the kinetic properties of recombinant P. furiosus CobD compare with homologous enzymes from mesophilic organisms?

While the search results don't provide specific kinetic data for P. furiosus CobD, we can draw informed comparisons based on patterns observed with other enzymes from this organism. Enzymes from hyperthermophiles like P. furiosus typically exhibit:

  • Lower catalytic activity (kcat) at mesophilic temperatures compared to mesophilic homologs

  • Higher activation energy

  • Optimal activity at temperatures near the organism's growth optimum (~95°C for P. furiosus)

  • Different substrate affinities that may reflect adaptations to the intracellular environment at high temperatures

Researchers investigating CobD should conduct comparative kinetic analyses across a temperature range of 37-100°C, examining parameters including:

ParameterExpected Pattern for P. furiosus CobD vs. Mesophilic Homologs
Temperature optimumSignificantly higher (likely 80-100°C)
Thermal stability (T50)Much higher denaturation temperature
Km at 37°CPotentially higher (lower affinity)
Km at 95°COptimized for physiological function
kcat at 37°CLower than mesophilic homologs
kcat at 95°CComparable to mesophilic enzymes at their optimal temperature
Catalytic efficiency (kcat/Km)Optimized for high-temperature function

These comparisons would provide valuable insights into the thermal adaptation strategies employed in CobD's evolution.

What expression systems are most effective for producing recombinant P. furiosus CobD?

Based on experiences with other P. furiosus enzymes, several expression systems can be considered for recombinant production of CobD:

  • E. coli expression systems: Standard prokaryotic expression hosts like E. coli BL21(DE3) with pET-based vectors provide a straightforward approach, though protein folding may be suboptimal for archaeal proteins. Consider:

    • Using specialized strains like Rosetta or Arctic Express to address codon bias and folding issues

    • Expression at reduced temperatures (15-25°C) to improve folding

    • Fusion tags (SUMO, MBP, TrxA) to enhance solubility

  • Archaeal expression hosts: For authentic post-translational modifications and proper folding, consider:

    • P. furiosus genetic tools for homologous expression

    • Temperature-shift approach as described for P. furiosus, where optimal growth at ~95°C is followed by an expression phase at more moderate temperatures

    • Cold-shock promoter control to avoid chemical inducers

  • Specialized commercial systems: For challenging proteins, commercial systems optimized for thermophilic proteins may offer advantages.

What purification strategies maximize yield and activity of recombinant P. furiosus CobD?

Effective purification of thermostable archaeal proteins like CobD can leverage their unique properties:

  • Heat treatment step: Exploit CobD's thermostability by heating crude cell lysates (70-80°C for 15-30 minutes) to precipitate host proteins while leaving CobD in solution.

  • Chromatographic approaches:

    • Immobilized metal affinity chromatography (IMAC) if His-tagged

    • Ion exchange chromatography (typically anion exchange)

    • Hydrophobic interaction chromatography

    • Size exclusion chromatography for final polishing

  • Buffer optimization:

    • Include reducing agents to prevent oxidation of cysteine residues

    • Consider archaeal-like salt concentrations for optimal folding

    • Evaluate stabilizing additives (glycerol, specific ions) that may enhance stability

  • Activity preservation:

    • Test storage conditions (temperature, buffer composition, additives)

    • Evaluate lyophilization potential for long-term storage

    • Monitor activity throughout purification to identify problematic steps

How can researchers effectively analyze the functional activity of P. furiosus CobD?

Functional characterization of P. furiosus CobD should include:

  • Decarboxylase activity assay development:

    • Direct measurement of L-threonine-O-3-phosphate decarboxylation

    • Detection of (R)-1-amino-propanol O-2- formation

    • Consider coupled enzyme assays if direct detection is challenging

  • Temperature-dependent activity profiling:

    • Measure activity across a temperature range (37-100°C)

    • Determine temperature optimum and activation energy

    • Assess thermal stability through activity retention after heat treatment

  • Substrate specificity analysis:

    • Test activity on L-threonine-O-3-phosphate and structural analogs

    • Determine kinetic parameters (Km, kcat, kcat/Km) for various substrates

    • Investigate potential allosteric regulations

  • In vivo functional complementation:

    • Following approaches used for cbiP and cbiB genes, test if P. furiosus cobD can complement cobD mutations in other organisms

    • Analyze restoration of cobalamin biosynthesis in complemented strains

How might P. furiosus CobD be utilized in biotechnological applications?

The thermostable nature of P. furiosus enzymes makes CobD potentially valuable for various applications:

  • Biocatalysis at elevated temperatures:

    • Organic synthesis of chiral amino alcohols

    • Decarboxylation reactions in industrial processes requiring high temperatures

    • Integration into multi-enzyme cascades for complex transformations

  • Analytical applications:

    • Development of thermostable enzyme-based biosensors

    • Analytical determination of L-threonine-O-3-phosphate in complex samples

  • Structural biology:

    • Model system for understanding enzyme thermostability

    • Platform for rational protein engineering of decarboxylases

Like the widely successful Pfu DNA polymerase, which gained prominence due to its proofreading ability and resulting lower error rates in PCR compared to Taq polymerase , CobD's unique properties may enable specialized applications that mesophilic enzymes cannot accommodate.

What approaches can be used to engineer CobD for enhanced catalytic properties or new functionalities?

Engineering CobD for improved or altered functions could employ several strategies:

  • Structure-guided mutagenesis:

    • Target active site residues to alter substrate specificity

    • Modify surface residues to enhance solubility or reduce aggregation

    • Introduce disulfide bonds to further increase thermostability

  • Directed evolution approaches:

    • Error-prone PCR to generate variants with improved properties

    • DNA shuffling with related decarboxylases to create chimeric enzymes

    • Compartmentalized self-replication for selecting variants with desired properties

  • Computational design:

    • In silico modeling to predict beneficial mutations

    • Molecular dynamics simulations to understand conformational flexibility

    • Sequence-based machine learning approaches to identify non-obvious mutational targets

  • Domain swapping and fusion strategies:

    • Create bifunctional enzymes by fusing CobD with complementary catalytic domains

    • Engineer allosteric regulation by incorporating regulatory domains

What are the current gaps in our understanding of archaeal cobalamin biosynthesis, and how might further studies of CobD address these?

Several knowledge gaps remain in our understanding of archaeal cobalamin biosynthesis:

  • Complete pathway elucidation:

    • Identification of all archaeal-specific enzymes in the pathway

    • Clarification of the precise role of CobD and its interaction with other pathway components

    • Understanding of pathway regulation under different growth conditions

  • Evolutionary implications:

    • Analysis of how archaeal and bacterial pathways diverged

    • Identification of selective pressures that shaped the archaeal-specific cobalamin pathway

    • Understanding of horizontal gene transfer events in the evolution of cobalamin biosynthesis

  • Structural biology:

    • Determination of CobD's three-dimensional structure at atomic resolution

    • Investigation of substrate binding and catalytic mechanism

    • Comparison with bacterial homologs to understand functional adaptations

  • Systems biology perspective:

    • Integration of CobD function into the broader metabolic network of P. furiosus

    • Understanding how cobalamin biosynthesis interfaces with other metabolic pathways

    • Quantitative modeling of pathway flux under different conditions

Future studies of CobD could address these gaps through integrated structural, biochemical, and genetic approaches, contributing to our broader understanding of archaeal metabolism and vitamin biosynthesis pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.