Recombinant Pyrococcus furiosus Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Cloning and Expression

  • Vector: pET-derived plasmids with C-terminal His₈-tag or pDEST17 for HTP cloning .

  • Induction: 0.5 mM IPTG at 37°C for 3 hours in E. coli Rosetta 2(DE3)pLysS .

  • Yield: Milligram quantities achieved via optimized detergent solubilization (octyl-β-D-glucoside) .

Purification Workflow

StepConditions
Membrane ExtractionDetergent: 1% octyl-β-D-glucoside
Affinity ChromatographyCobalt-based resin (His tag binding)
Anion-ExchangeQ Sepharose column; pH 8.0
Size-Exclusion ChromatographyFinal polishing step to ensure monodispersity

Biological Role

HtpX prevents accumulation of misfolded membrane proteins under stress:

  • Heat Shock: Transcript levels increase in P. furiosus at elevated temperatures .

  • Oxidative Stress: Protein abundance rises in Haloferax volcanii during oxidative damage .

Catalytic Mechanism

  • Zinc Coordination: Requires His139 and His143 for zinc binding; disrupted by H139F mutation .

  • Self-Cleavage: Wild-type HtpX undergoes autocatalysis at Leu260 unless inactivated by E222Q mutation .

Industrial Relevance

  • Thermostability: Retains activity near 100°C, ideal for biotechnological processes .

  • Protein Engineering: Serves as a template for designing heat-resistant proteases .

Comparative Analysis

HtpX homologs across archaea share conserved domains but vary in regulatory features:

OrganismHomologRegulatory DomainStress Response
Haloferax volcaniiHVO_A0045NoneOxidative stress
Escherichia coliHtpXCpxA systemMembrane protein stress

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; PF1135; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Target Names
htpX
Target Protein Sequence
MGIGLWVRTGLLMAFLTGLLVGIGYLIGGQGGMIIAFTIALFMNFFSYWFSDSIVLSWYN ARIVSEEEAPELHRIVEKLAMQAGIPKPRVAIVPTLVPNAFATGRSPEHAVVAVTEGLLR ILNRDELEGVIAHEISHIKNRDTLIQTIAAVLAGAIMVLVNFARWSLWFGAYDEDRDGGN IVALILAIILAPIAATLIQLAISRSREYLADETGAKISGKPHALASALMKIEEAVRYRPL KNGNPATAHMFIVNPFRGVDFVELFSTHPPTEKRIERLRKIAMEMGIIF
Uniprot No.

Target Background

Database Links

KEGG: pfu:PF1135

STRING: 186497.PF1135

Protein Families
Peptidase M48B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Pyrococcus furiosus Protease HtpX homolog and what is its biological significance?

HtpX is a membrane-localized protease found in the hyperthermophilic archaeon Pyrococcus furiosus, which grows optimally at temperatures near 100°C . In P. furiosus, increased HtpX transcript levels have been detected under heat shock conditions, suggesting a role in the cellular stress response . Similar to its bacterial counterparts, archaeal HtpX likely participates in membrane protein quality control, particularly during stress conditions . The ability to function at extremely high temperatures makes this protease particularly interesting for both fundamental research and potential biotechnological applications. The study of HtpX contributes to our understanding of protein homeostasis mechanisms in extremophiles and the molecular adaptations that allow for enzyme function under extreme conditions.

What are the optimal methods for recombinant expression of P. furiosus HtpX?

For recombinant expression of P. furiosus proteins, including membrane proteases like HtpX, the following methodological approach has proven effective:

  • Vector selection: pET19b expression vector or pDEST17 vector systems under IPTG-inducible control have been successfully used for P. furiosus proteins .

  • Host strain: Escherichia coli Strain Rosetta 2(DE3)pLysS has demonstrated high efficiency for expressing P. furiosus genes, with studies showing successful expression of 55 out of 80 tested genes .

  • Cloning strategy: Ligase-independent cloning (LIC) methods using phosphorothioate-modified primers and λ exonuclease digestion have achieved positive clone percentages of ≥80% in 96-well plate format, making this approach suitable for high-throughput expression studies .

  • PCR amplification: Using KOD-plus DNA polymerase for target gene amplification, followed by T4 polynucleotide kinase treatment to phosphorylate PCR products .

For membrane proteins like HtpX, additional considerations include optimizing detergent conditions during extraction and purification to maintain protein stability and activity while ensuring proper solubilization from the membrane.

What challenges are typically encountered when purifying active recombinant P. furiosus HtpX?

Purifying active recombinant P. furiosus HtpX presents several methodological challenges:

  • Membrane protein solubilization: As a membrane-associated protease, HtpX requires careful selection of detergents for extraction from the membrane while maintaining its native structure and activity.

  • Thermostability during purification: While P. furiosus proteins are extremely thermostable in their native environment, recombinant versions expressed in mesophilic hosts may exhibit different folding properties and stability characteristics.

  • Proteolytic activity control: Preventing unwanted self-cleavage or degradation of other proteins during the purification process may require the use of specific protease inhibitors or optimized buffer conditions.

  • Proper folding in heterologous hosts: The expression of archaeal membrane proteins in E. coli may result in improper folding or inclusion body formation, necessitating refolding procedures or alternative expression systems.

  • Post-translational modifications: Any archaeal-specific post-translational modifications required for HtpX activity may be absent in bacterial expression systems.

To address these challenges, researchers might consider implementing strategies such as expression at lower temperatures, use of specialized E. coli strains designed for membrane protein expression, or exploring archaeal-based expression systems when available.

How is HtpX expression regulated in Pyrococcus furiosus?

The regulation of HtpX expression in P. furiosus appears to be closely tied to stress response mechanisms. Increased HtpX transcript levels were detected in P. furiosus under heat shock conditions (Shockley et al., 2003), suggesting transcriptional regulation in response to thermal stress . This observation aligns with the organism's hyperthermophilic nature and the likely role of HtpX in protein quality control at extreme temperatures.

While specific studies on the promoter elements and transcription factors controlling HtpX expression in P. furiosus are not detailed in the provided sources, the regulation likely involves stress-responsive transcription factors. In comparative studies, northern blot analysis techniques have been successfully used to detect stress-induced transcripts in P. furiosus, as demonstrated for small heat shock proteins (600 nucleotides transcript detected after exposure to 105°C) .

For researchers investigating HtpX regulation, quantitative RT-PCR and promoter analysis would be valuable approaches to elucidate the specific regulatory mechanisms controlling HtpX expression under various stress conditions.

What is the role of HtpX in membrane protein quality control in archaea?

HtpX likely plays a crucial role in membrane protein quality control in archaea, similar to its function in bacteria. Several lines of evidence support this hypothesis:

  • Stress-responsive expression: Increased HtpX transcript levels under heat shock in P. furiosus and increased protein abundance during oxidative stress in H. volcanii suggest its involvement in stress response mechanisms .

  • Membrane protein degradation: As a membrane-localized protease, HtpX likely participates in the degradation of misfolded or damaged membrane proteins, helping maintain membrane integrity under stress conditions.

  • Functional relationships with other proteases: In H. volcanii, the HtpX homolog HVO_A0045 showed differential expression (increased abundance) in a strain lacking the rhomboid homolog RhoII, suggesting potential functional relationships or compensatory mechanisms among membrane proteases .

Research methodologies to further investigate HtpX's role could include:

  • Generating knockout mutants and analyzing membrane protein profiles

  • Identifying natural substrates through proteomics approaches

  • Structural studies to characterize substrate binding sites and catalytic mechanisms

What approaches can be used to identify natural substrates of HtpX in P. furiosus?

Identifying natural substrates of HtpX in P. furiosus requires sophisticated methodological approaches:

  • Comparative proteomics: Comparing membrane protein profiles between wild-type and htpX-deficient strains can reveal potential substrates that accumulate in the absence of HtpX. This approach has been used successfully for studying membrane proteases in H. volcanii, where differential protein expression was observed in protease mutants .

  • Substrate trapping: Engineering catalytically inactive HtpX variants that can bind but not cleave substrates, followed by co-immunoprecipitation and mass spectrometry analysis.

  • In vitro degradation assays: Purifying recombinant HtpX and testing its activity against candidate substrate proteins under controlled conditions.

  • Crosslinking approaches: Using chemical crosslinkers to capture transient protease-substrate interactions, followed by identification of crosslinked proteins by mass spectrometry.

  • Bioinformatic prediction: Analyzing the P. furiosus proteome for proteins with sequence or structural features similar to known HtpX substrates in other organisms.

The high-throughput expression system developed for P. furiosus proteins could provide a valuable resource for these studies, allowing the expression and purification of potential substrate proteins for in vitro validation .

How can recombinant P. furiosus HtpX be utilized in structural genomics initiatives?

Recombinant P. furiosus HtpX represents a valuable target for structural genomics initiatives due to several factors:

  • Contribution to archaeal proteolysis understanding: Structural characterization of HtpX would enhance our understanding of membrane protein quality control mechanisms in archaea.

  • Thermostable enzyme insights: The structural basis for extreme thermostability in P. furiosus enzymes is of significant interest for protein engineering applications.

  • Integration with existing resources: The recombinant expression library of P. furiosus provides a platform for structural studies of HtpX and potential interaction partners . Over two hundred protein structures from P. furiosus have already been released in the PDB, creating a rich structural context for interpreting HtpX studies .

For structural studies, researchers could employ:

  • X-ray crystallography of solubilized and purified HtpX

  • Cryo-electron microscopy for visualizing membrane-embedded conformations

  • NMR studies of specific domains or substrate interactions

The methodological approach used to construct the P. furiosus expression library (ligase-independent cloning) provides an efficient pipeline for generating constructs with various affinity tags or truncations to facilitate structural studies .

What are the key experimental considerations when studying the effects of heat shock on HtpX function?

When investigating heat shock effects on HtpX function in P. furiosus, researchers should consider several methodological aspects:

  • Appropriate temperature selection: For P. furiosus, heat shock experiments should utilize temperatures above its optimal growth temperature (~100°C). Previous studies have used 105°C for heat shock treatments .

  • Transcript analysis methodology: Northern blot analysis with radiolabeled PCR probes has been successfully used to detect heat shock-induced transcripts in P. furiosus, with glutamate dehydrogenase (GDH) serving as a constitutively expressed control .

  • Protein stability assessment: When studying heat-induced changes in HtpX activity, researchers must distinguish between effects on expression levels versus changes in the intrinsic activity of existing protein.

  • Experimental controls: Include non-heat-shocked controls and constitutively expressed genes as references. For example, studies with P. furiosus small heat shock protein used glutamate dehydrogenase as a control because it is expressed constitutively .

  • Time-course analysis: Temporal patterns of HtpX expression and activity during and after heat shock provide insights into its regulatory dynamics. Previous heat shock studies in P. furiosus have monitored responses for up to 120 minutes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.