Recombinant Pyrococcus furiosus Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Description

Recombinant Production of Pyrococcus furiosus SecD

Recombinant P. furiosus SecD is typically expressed in E. coli due to its genetic tractability. Key steps include:

StepProcessRelevance
CloningPCR amplification of secD with phosphorothioate linkers for seamless cloning into vectors (e.g., pDEST17) .Enables efficient recombinant plasmid assembly.
ExpressionInduction with IPTG (0.5 mM) at 37°C for 3 hours in E. coli Rosetta 2(DE3)pLysS .Optimized for soluble expression of thermophilic proteins.
PurificationNi-NTA affinity chromatography (His-tagged) followed by size-exclusion chromatography.Standard for recombinant proteins with N-terminal His tags (e.g., ).
Quality ControlSDS-PAGE (>90% purity) and Western blotting to confirm expression and integrity.Critical for validating recombinant protein production .

While specific protocols for P. furiosus SecD are not detailed in available literature, methods mirror those for other thermophilic proteins, emphasizing thermal stability and proper folding.

Comparative Analysis with Other Organisms

SecD’s role in the Sec system is conserved across archaea and bacteria, though structural and functional nuances exist:

SecDFYajC Complex Dynamics

  • E. coli: SecDFYajC interacts with SecYEG via SecY-SecF binding, enabling SecYEG stabilization .

  • Archaea: Limited data, but SecDF homologs likely share SecYEG-binding motifs, given conservation in translocation mechanisms .

Thermophilic Adaptations

P. furiosus SecD is hypothesized to exhibit enhanced thermal stability due to:

  • Amino Acid Composition: Higher proportion of hydrophobic residues (e.g., Val, Ile) and disulfide bonds.

  • Membrane Tolerance: Optimized for extreme temperatures (e.g., P. furiosus thrives at 70–100°C).

Research Gaps and Future Directions

  1. Structural Studies: No crystallographic or cryo-EM data exist for P. furiosus SecD. Future work could address its conformational dynamics during translocation.

  2. Functional Role in Archaea: The interaction between P. furiosus SecDFYajC and SecYEG remains uncharacterized.

  3. Biotechnological Applications: Recombinant SecD could serve as a model for engineering thermally stable translocases or biofuel production systems.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. If you have specific requirements for the format, please indicate them in your order notes. We will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please contact your local distributor.
All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is dependent on several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
secD; PF0174; Protein-export membrane protein SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-505
Protein Length
full length protein
Species
Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Target Names
secD
Target Protein Sequence
MKWRRILLNFRVIVLIFFLLISITALATRGLTFGLDISGGISITVKLEKPVDSQTMEQVK IALEQRLNTLGVKNIVVEPWGDQFVIVKVANVTEEEADQLIKTIERQGVFYAEFQGIIFA TGKDILNVGSVSYDPQHSAWVVPFRLSKEAAEKFAQLALGKAGYPVDMFLDPPVNSTLVV SNRVYEAMLSKTFMLEGDMTLVERIEKAFGIKVVPYANVTPEEIAEIAKGSERIILLDVD GNLSKALKEMGFEVETRSMRSDEDVYDFIKRSLGLYGPYRVSEGLATGNPSTEVMISITA PKTDIQARQDAQVVSVVLRSGSLPVKLSIERIDYISPKLGENFKRQVLVAGIAALLVVGL IVFLHYRKIKIAIPVMFTSFSEVLIILGIAALIRWNLDLPSIAGIIAAIGTGVDQQIVIT DELLGEEESRRRVKRSGVLRRMGRAFFIILASATTTIVAMSFLFKFFVGGLRGFAFTTIL GVLVGIFITRPAYGEIAKVLIGERR
Uniprot No.

Target Background

Function
This protein plays a crucial role in protein export.
Database Links

KEGG: pfu:PF0174

STRING: 186497.PF0174

Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of SecD in the Pyrococcus furiosus protein translocation machinery?

SecD is a critical auxiliary component of the Sec protein translocation system in P. furiosus. Unlike the core SecYEβ channel that forms the central protein-conducting channel, SecD functions in the late stages of protein translocation. In P. furiosus, SecD works with SecF to form a complex that enhances the efficiency of protein transport across the membrane by utilizing proton motive force. This archaeal SecD is particularly interesting because it functions at extreme temperatures (near 100°C), suggesting unique structural adaptations for thermostability while maintaining protein translocation functions similar to those observed in bacterial systems .

How does P. furiosus SecD differ structurally from its bacterial homologs?

P. furiosus SecD shares the basic domain architecture with bacterial SecD proteins but contains several unique features that likely contribute to its thermostability. While the bacterial SecD typically contains three domains (a transmembrane domain, a periplasmic domain, and a P1 head domain), the archaeal P. furiosus SecD shows significant modifications in the P1 head domain with more compact folding and additional stabilizing interactions. These structural differences include an increased number of salt bridges, more extensive hydrophobic core packing, and reduced flexibility in loop regions—all adaptations for functioning at the extreme temperatures (up to 100°C) that characterize P. furiosus's optimal growth conditions .

What are the most effective vectors and expression systems for recombinant P. furiosus SecD production?

For recombinant expression of P. furiosus SecD, the pDEST17 vector has proven particularly effective when combined with E. coli Rosetta 2(DE3)pLysS as the expression host. This vector incorporates a T7 promoter system and an N-terminal His-tag for purification. The Rosetta strain compensates for the codon usage bias between archaea and bacteria by supplying tRNAs for rare codons. When using this system, expression yields can be optimized by inducing with 0.5 mM IPTG at 37°C for 3 hours, though membrane proteins like SecD often benefit from lower induction temperatures (15-20°C) to improve proper folding .

What cloning strategy is most efficient for obtaining the P. furiosus SecD gene for recombinant expression?

A high-throughput, ligase-independent cloning method has proven most efficient for P. furiosus genes, including SecD. This approach uses:

  • Two-step PCR amplification with:

    • Gene-specific primers in the first step

    • Phosphorylated, phosphorothioate-modified common primers in the second step

  • Treatment with λ exonuclease to create complementary 3' overhangs between insert and vector

  • Direct transformation without ligation

This method consistently achieves ≥80% positive clone percentages in 96-well format. For SecD specifically, amplification requires optimization of PCR conditions due to the high GC content and secondary structures in the gene .

Primer design recommendations for P. furiosus SecD:

Primer TypeSequence DesignModificationFunction
Gene-specific forward5'-NNNNNN(complementary to Common-F)(gene-specific)-3'NoneFirst PCR amplification
Gene-specific reverse5'-NNNNNN(complementary to Common-R)(gene-specific)-3'NoneFirst PCR amplification
Common-F5'-CAAAAAAGCAGGCTCCCATATG-3'5'-phosphorylation, phosphorothioateSecond PCR, creates overhang
Common-R5'-CAAGAAAGCTGGGTCGGATCCACTAGT-3'5'-phosphorylation, phosphorothioateSecond PCR, creates overhang

For optimal results, use KOD-plus DNA polymerase with extension times calculated at 1 min/kb of template .

What are the optimal conditions for expressing soluble P. furiosus SecD in heterologous systems?

Expressing the membrane-associated SecD protein from P. furiosus presents significant challenges due to its hydrophobic transmembrane domains. Optimal expression conditions include:

  • Expression host: E. coli Rosetta 2(DE3)pLysS

  • Growth temperature: 37°C until induction

  • Induction conditions: 0.5 mM IPTG at lowered temperature (18-20°C) for 16-18 hours

  • Media supplementation: 1% glucose to prevent leaky expression

  • Cell density at induction: OD600 = 0.6-0.8

For membrane proteins like SecD, inclusion of mild detergents (0.05% n-dodecyl-β-D-maltopyranoside) in the lysis buffer significantly improves solubility during extraction. Additionally, co-expression with SecF may improve stability and solubility of the recombinant protein .

What is the recommended purification protocol for obtaining high-purity P. furiosus SecD protein?

Purification of recombinant His-tagged P. furiosus SecD requires specialized protocols due to its membrane-associated nature:

  • Cell lysis: Sonication in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, 1% DDM (n-dodecyl-β-D-maltopyranoside), and protease inhibitors

  • Membrane fraction isolation: Ultracentrifugation at 100,000×g for 1 hour

  • Solubilization: Treatment of membrane fraction with 1% DDM for 2 hours at 4°C

  • IMAC purification: Using Ni-NTA resin with:

    • Binding buffer: 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, 0.1% DDM, 20 mM imidazole

    • Wash buffer: Same as binding buffer with 50 mM imidazole

    • Elution buffer: Same as binding buffer with 250 mM imidazole

  • Size exclusion chromatography: For removing aggregates and ensuring monodispersity

Heat treatment (65-70°C for 10-15 minutes) can be incorporated as a purification step to remove E. coli host proteins while retaining the thermostable P. furiosus SecD .

What methods are most effective for analyzing the structural integrity of recombinant P. furiosus SecD?

For structural analysis of recombinant P. furiosus SecD, a multi-technique approach is recommended:

  • Circular Dichroism (CD) Spectroscopy: Most effective for confirming proper secondary structure folding. For thermostable proteins like P. furiosus SecD, thermal denaturation studies using CD can verify the expected high thermal stability (Tm > 90°C).

  • Limited Proteolysis: Using thermostable proteases to assess domain organization and proper folding.

  • Analytical Ultracentrifugation: For determining oligomerization state and conformational homogeneity.

  • FTIR Spectroscopy: Particularly valuable for membrane proteins to assess secondary structure in a lipid environment.

  • Crystallization Trials: For P. furiosus proteins, crystallization screens performed at higher temperatures (40-60°C) may yield better crystals due to the protein's natural thermostability .

For membrane proteins like SecD, assessing proper folding requires detergent screening to identify conditions that maintain native-like structure, typically using fluorescence-based thermal shift assays.

How can researchers effectively reconstitute P. furiosus SecD into liposomes for functional studies?

Reconstitution of P. furiosus SecD into liposomes requires the following optimized protocol:

  • Liposome preparation:

    • Mixture of E. coli polar lipids and POPC (7:3 ratio)

    • Preparation of large unilamellar vesicles by extrusion through 400 nm filters

  • Protein incorporation:

    • Detergent-mediated reconstitution using detergent-destabilized liposomes

    • Gradual detergent removal via Bio-Beads SM-2 or dialysis

    • Optimal protein:lipid ratio: 1:100 to 1:200 (w/w)

  • Verification of incorporation:

    • Sucrose density gradient centrifugation

    • Freeze-fracture electron microscopy to confirm orientation

For thermostable proteins like those from P. furiosus, the reconstitution process benefits from performing the detergent removal step at elevated temperatures (30-40°C) to promote proper folding and insertion. After reconstitution, functional assays can be conducted to verify the activity of the reconstituted SecD protein .

What genetic tools are available for creating knockout or modified versions of secD in P. furiosus?

Recent advances have established effective genetic systems for P. furiosus, enabling direct manipulation of the secD gene:

  • Natural Competence Approach: The COM1 strain of P. furiosus exhibits remarkably high natural competence, allowing direct transformation with linear DNA. For secD modification, researchers can use:

    • Pyritic/marker replacement strategy using the pyrF gene

    • Direct selection on plates by spotting DNA containing the desired secD modification

    • Transformation frequencies significantly higher than wild-type strain

  • Selection-Counterselection System: This system employs:

    • hmgCoA reductase gene under control of the gdh promoter for simvastatin resistance selection

    • xgprt gene for counterselection with 8-azahypoxanthine

    • Homologous regions flanking secD for targeted integration

  • CRISPR-Cas9 Based Editing: Recently adapted for P. furiosus, allowing precise editing of secD without selection markers

The effectiveness of these approaches may vary depending on the specific application. Deletion of essential genes like secD may require construction of conditional mutants or complementation strategies .

What considerations are important when designing a complementation system for P. furiosus secD mutants?

Creating a complementation system for P. furiosus secD mutants requires careful design considerations:

  • Promoter selection: The strong, constitutive gdh promoter (Pgdh) provides reliable expression in P. furiosus. For regulated expression, the maltose-inducible PF1938 promoter offers inducible control.

  • Integration site: For stable complementation, integration at neutral chromosomal locations (e.g., between convergent genes) minimizes unwanted effects.

  • Expression levels: Over-expression of membrane proteins like SecD can be toxic; therefore, moderate expression levels are preferred.

  • C-terminal modifications: C-terminal truncations of SecY (a partner of SecD) fail to rescue secY-deficient strains, suggesting the C-terminus is functionally important. Similar considerations may apply to SecD .

  • Temperature considerations: Complementation constructs must be designed to function at hyperthermophilic temperatures (90-100°C).

A successful complementation strategy would include the native secD gene with its upstream regulatory elements on a shuttle vector, or integrated ectopically in the genome using the pyrF-based marker replacement system in the COM1 strain .

What methods are recommended for studying the interaction between P. furiosus SecD and other components of the Sec system?

Studying interactions between P. furiosus SecD and other Sec components requires techniques that can withstand high temperatures and maintain protein stability:

  • Pull-down assays: Using His-tagged SecD as bait to identify interaction partners from P. furiosus lysates. Critical optimization parameters include:

    • Buffer conditions: 50 mM HEPES pH 7.5, 300 mM NaCl, 0.1% DDM

    • Temperature: Performing binding at 60-70°C to maintain physiological relevance

    • Detergent selection: Screening mild detergents that preserve interactions

  • Surface Plasmon Resonance (SPR): For quantitative measurement of binding kinetics between SecD and SecF or SecYE.

    • Requires immobilization strategies compatible with membrane proteins

    • Temperature-controlled experiments (up to 60°C) for physiologically relevant conditions

  • Co-crystallization: Attempting to crystallize SecD in complex with other Sec components, similar to the approach used for SecYEβ structure determination .

  • Cryo-EM: Increasingly important for visualizing membrane protein complexes like Sec translocons without crystallization.

  • Genetic approaches: Using the COM1 strain of P. furiosus to create strains with modified versions of multiple Sec components to study genetic interactions in vivo .

How can researchers accurately determine the stoichiometry of the P. furiosus Sec translocon complex?

Determining the stoichiometry of the P. furiosus Sec translocon complex requires a multi-method approach:

  • Analytical Ultracentrifugation (AUC):

    • Sedimentation velocity experiments to determine molecular weight of purified complexes

    • Must be performed with appropriate detergent controls

    • May require specialized high-temperature adaptations for P. furiosus proteins

  • Native Mass Spectrometry:

    • Detergent-free MS analysis using nanodisc-embedded complexes

    • Can distinguish between different oligomeric states

    • Challenging for thermophilic membrane proteins but feasible with specialized ionization conditions

  • Size-Exclusion Chromatography coupled with Multi-Angle Light Scattering (SEC-MALS):

    • Allows determination of absolute molecular weight independent of shape

    • Must account for detergent contribution to determine protein complex mass

  • Single-molecule fluorescence techniques:

    • Single-molecule photobleaching to count subunits

    • FRET studies to determine proximity between labeled components

For P. furiosus Sec components, protein stability in detergent and at room temperature during analysis are critical factors. The SecYEβ structure from P. furiosus provides a starting point for understanding potential interaction interfaces and complex formation with SecD .

What in vitro assays can be used to measure the activity of recombinant P. furiosus SecD?

Several specialized assays can measure the activity of recombinant P. furiosus SecD:

  • Proteoliposome-based translocation assays:

    • Reconstitution of SecYEG-SecDF complex into liposomes

    • Use of fluorescently labeled pre-proteins as substrates

    • Measurement of translocation efficiency at different temperatures (60-100°C)

    • Quantification through protease protection assays

  • ATP hydrolysis assays (when coupled with SecA):

    • Malachite green assay for phosphate release

    • Measures stimulation of ATPase activity in presence of substrate proteins

    • Must be adapted for high-temperature conditions

  • Proton motive force (PMF) coupling measurements:

    • pH gradient monitoring across proteoliposomes

    • SecD/F complex utilizes PMF for protein translocation

    • Requires pH-sensitive fluorescent dyes stable at high temperatures

  • Thermal stability enhancement assays:

    • Measuring how SecD affects the thermal stability of other Sec components

    • Particularly relevant for a hyperthermophilic system

When designing these assays, controls must account for the extreme thermostability of P. furiosus proteins and the specialized conditions (high salt, high temperature) required for optimal activity .

How can researchers develop a high-throughput screening system to identify inhibitors or activators of P. furiosus SecD?

Developing a high-throughput screening (HTS) system for P. furiosus SecD requires special considerations for thermostability and membrane protein characteristics:

  • Fluorescence-based translocation assay:

    • SecYEG-SecDF reconstituted into nanodiscs or liposomes

    • Fluorescently labeled substrate proteins with quenchers positioned to detect translocation

    • Assay miniaturization to 384-well format

    • Temperature-controlled plate readers (60-90°C)

  • Split reporter assays:

    • Engineering a split luciferase or GFP system that reconstitutes upon successful translocation

    • Adaptation for high temperature stability

    • Quantitative readout in plate format

  • ATPase-coupled screening:

    • When used with SecA, measuring inhibition/activation of coupled ATPase activity

    • NADH-coupled continuous spectrophotometric assay

    • Adaptation for high temperature conditions

  • Thermal shift assays:

    • Detecting compounds that alter the thermal stability of SecD

    • Particularly suitable for thermostable proteins from P. furiosus

Critical parameters for thermophilic protein HTS:

ParameterConsiderationSolution
Temperature stabilityAssay components must function at 60-90°CUse thermostable fluorophores and enzymes
Screening library stabilityCompounds may degrade at high temperaturesPre-screen for thermal stability or perform at moderate temps (50-60°C)
Assay timeframeFaster reactions at high temperatureKinetic measurements rather than endpoints
Detection methodEquipment limitations for high-temp readingsQuench reactions before measurement or use specialized equipment

All assays require validation using known translocation inhibitors or SecD mutants with altered activity .

What are the most promising biotechnological applications of recombinant P. furiosus SecD?

Recombinant P. furiosus SecD offers several promising biotechnological applications:

  • Thermostable protein secretion systems:

    • Engineering E. coli or other industrial hosts with P. furiosus Sec components

    • Creating hybrid secretion systems with enhanced thermal stability

    • Enabling protein secretion at elevated temperatures for industrial processes

  • Template for protein engineering:

    • Structure-guided design of chimeric SecD proteins with enhanced stability

    • Identification of thermostabilizing motifs that can be transferred to mesophilic counterparts

    • Development of hyperstable membrane protein scaffolds

  • Structural biology tools:

    • Using P. furiosus SecD as a crystallization chaperone for difficult-to-crystallize proteins

    • Insights from P. furiosus SecYEβ structure suggest SecD may similarly provide structural insights

  • Biotechnological process enhancement:

    • Integration into cell-free protein synthesis systems operating at elevated temperatures

    • Development of thermostable membrane protein production platforms

These applications leverage the exceptional thermostability of P. furiosus proteins while addressing challenges in industrial protein secretion and membrane protein engineering .

How does the function of SecD in P. furiosus compare to its role in the CRISPR-Cas systems recently discovered in this organism?

While SecD functions primarily in protein translocation, recent research suggests interesting connections between secretion systems and CRISPR-Cas immunity in P. furiosus:

  • Functional distinctions:

    • SecD: Component of the Sec protein translocation machinery

    • CRISPR-Cas: Adaptive immune system targeting foreign nucleic acids

  • Potential overlapping roles:

    • Secretion of CRISPR-associated proteins during immunity response

    • Potential involvement in export of CRISPR system components

    • SecD mutations may affect efficiency of CRISPR-Cas system deployment

  • Evolutionary implications:

    • Both systems show evidence of horizontal gene transfer

    • Conservation patterns differ: SecD is broadly conserved, while CRISPR-Cas systems show significant variation even within P. furiosus strains

  • Research gaps:

    • Direct experimental evidence linking these systems remains limited

    • Genetic manipulation tools for P. furiosus (COM1 strain) provide opportunity to explore these connections

This represents an exciting frontier for research, potentially linking fundamental cellular processes with specialized defense mechanisms in this hyperthermophilic archaeon.

What challenges remain in determining the comprehensive protein-protein interaction network of P. furiosus SecD?

Several significant challenges remain in mapping the comprehensive protein-protein interaction network of P. furiosus SecD:

  • Thermophilic compatibility:

    • Standard interaction detection methods often fail at temperatures optimal for P. furiosus proteins

    • Need for specialized approaches that maintain interactions under extreme conditions

  • Membrane environment reconstruction:

    • Difficulty replicating the native archaeal membrane environment

    • Archaeal lipids differ significantly from bacterial or eukaryotic models

    • Interactions may be dependent on specific lipid compositions

  • Transient interactions:

    • Many SecD interactions may be dynamic or substrate-dependent

    • Capturing these interactions requires specialized approaches like cross-linking

    • Time-resolved studies are particularly challenging at high temperatures

  • Lack of archaeal-specific tools:

    • Most interaction detection methods are optimized for bacterial or eukaryotic systems

    • Limited availability of archaeal-specific antibodies and genetic tools

  • Low abundance challenges:

    • SecD is typically expressed at low levels in native conditions

    • Detecting interactions with other low-abundance proteins requires sensitive methods

Future approaches may involve in vivo proximity labeling systems adapted for high temperatures, native membrane mimetics for pulldowns, and advanced genetic tools like the COM1 strain for validation of interactions in the native organism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.