Recombinant Pyrococcus furiosus Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

SecF forms part of the SecDF complex in the Sec translocase system, which facilitates post-translational protein export. In P. furiosus, SecF (encoded by secF, locus PF0173) partners with SecD and YajC to mediate translocation of unfolded proteins across the cytoplasmic membrane . This complex is essential for maintaining protein secretion efficiency, particularly under stress conditions, by coupling proton motive force to translocation .

Recombinant Expression and Purification

Recombinant P. furiosus SecF is produced in Escherichia coli using a high-throughput cloning strategy:

  • Vector: pDEST17 with N-terminal His-tag .

  • Host strain: Rosetta 2(DE3)pLysS for optimal expression .

  • Induction: 0.5 mM IPTG at 37°C for 3 hours .

Key parameters for expression optimization:

  • Protease K treatment enhances cloning efficiency by reducing DNA polymerase interference .

  • SDS-PAGE confirms expression of the ~35 kDa protein .

Biochemical Properties

Recombinant SecF is stabilized in Tris-based buffer with 50% glycerol at -20°C . Functional assays highlight its role in:

  • Translocon priming: Stabilizing SecYEG interaction during substrate engagement .

  • Proton motive force coupling: Enhancing translocation rates under ATP-limiting conditions .

Applications and Research Utility

Recombinant SecF is utilized in:

  • Structural studies: Investigating translocon dynamics via cryo-EM and X-ray crystallography .

  • Industrial enzymology: Serving as a thermostable model for membrane protein engineering .

Unresolved Questions

  • How does P. furiosus SecDFYajC interact with its unique chaperones in hyperthermophilic conditions?

  • What role does YajC play in archaeal protein translocation ?

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
secF; PF0173; Protein-export membrane protein SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-296
Protein Length
full length protein
Species
Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Target Names
secF
Target Protein Sequence
MPEVDNVIKEKLKLLVEMDPKKMIIYPLIVFGIAIIIIIANYVMTGSFVKEGIELRGGSV ITLQGVNVSPDEIAKSIKEKTGIDVTVEKFSGVGGSGVRVYVSAGDDVNLVREALKEMFP DVEPQTVVIGPTFGEIVREQGIKAIVYAFIGMAIVVFLFFRVPVPSMTVVFSAFSDMIIA IALMNIFGIELSQATIAALLMLIGYSVDSNILLTTRLLRRKEFTVEEAYYSSLKTGFTMS TTTLGALASLWIFSTAQVIDDIASVLIFGLLADFMNTWILNAGVLRLYIAKREGKE
Uniprot No.

Target Background

Function
SecF plays a crucial role in protein export.
Database Links

KEGG: pfu:PF0173

STRING: 186497.PF0173

Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Pyrococcus furiosus Protein translocase subunit SecF and what is its biological function?

Protein translocase subunit SecF from Pyrococcus furiosus is a component of the Sec protein translocation system, which is responsible for protein secretion across cytoplasmic membranes. The SecF protein functions as part of the SecDF complex that uses the proton motive force to facilitate protein translocation. In P. furiosus, this protein is particularly interesting due to the organism's hyperthermophilic nature, growing optimally near 100°C, making its proteins valuable resources for industrial and molecular biological applications . The SecF protein (Uniprot ID: Q8U4B5) consists of 296 amino acids and is encoded by the secF gene (locus name: PF0173) .

What expression systems are recommended for recombinant production of P. furiosus SecF?

For recombinant expression of P. furiosus proteins including SecF, Escherichia coli strain Rosetta 2(DE3)pLysS has been successfully used. This strain is particularly suitable because it contains codons rarely used in E. coli but potentially present in P. furiosus genes. For optimal expression, the pDEST17 vector system can be used with IPTG induction at a final concentration of 0.5 mM at 37°C for 3 hours. Small-scale expression experiments have demonstrated that approximately 69% (55 out of 80) of P. furiosus genes can be efficiently expressed in this E. coli host, making it a viable system for SecF expression .

What are the recommended storage conditions for recombinant P. furiosus SecF protein?

Recombinant P. furiosus SecF protein should be stored in Tris-based buffer with 50% glycerol, optimized specifically for this protein. Short-term storage can be maintained at -20°C, while for extended storage, it is recommended to conserve the protein at either -20°C or -80°C. For working aliquots, storage at 4°C is suitable but should be limited to one week. Repeated freezing and thawing cycles should be avoided to maintain protein integrity and activity .

What cloning methods are most effective for P. furiosus SecF gene?

A highly efficient ligase-independent cloning (LIC) method using phosphorothioate-modified primers and λ exonuclease digestion has proven effective for cloning P. furiosus genes, including SecF. This method involves:

  • Two-step PCR amplification using gene-specific and phosphorothioate-modified common primers

  • PCR amplification of the expression vector (e.g., pDEST17)

  • λ exonuclease treatment to create complementary 3' overhangs

  • Direct transformation into E. coli DH5α without ligation

This approach has demonstrated a positive clone percentage of ≥80% in 96-well plate format, making it suitable for high-throughput cloning of P. furiosus genes .

How does the thermostability of P. furiosus SecF compare to mesophilic homologs, and what structural features contribute to this property?

The thermostability of P. furiosus SecF is significantly higher than its mesophilic counterparts due to several structural adaptations. P. furiosus, growing optimally near 100°C, has evolved proteins with enhanced thermostability features including:

  • Increased ionic interactions and salt bridges

  • Higher proportion of hydrophobic amino acids in the protein core

  • Reduced number of thermolabile residues

  • More compact protein folding with fewer surface loops

When designing experiments to study these thermostability features, researchers should implement comparative structural analysis between P. furiosus SecF and mesophilic homologs using circular dichroism spectroscopy at different temperatures, differential scanning calorimetry, and thermal shift assays. X-ray crystallography or cryo-EM studies can further elucidate the specific structural elements contributing to thermostability .

What challenges might researchers encounter when performing functional assays with recombinant P. furiosus SecF, and how can these be addressed?

Researchers working with recombinant P. furiosus SecF may encounter several challenges during functional assays:

ChallengeSolution ApproachMethodological Considerations
Maintaining protein activity at mesophilic assay conditionsUse thermostable buffer systemsPhosphate buffers with stabilizing agents like glycerol or specific ions
Reconstituting membrane protein function in vitroLiposome reconstitutionUse archaeal lipids or synthetic lipids that maintain fluidity at high temperatures
Assessing protein translocation activityDevelop thermostable reporter systemsEngineer GFP variants or enzyme reporters that remain functional at elevated temperatures
Partner protein interactionsCo-expression with other Sec componentsDesign dual expression systems for SecD and other Sec pathway proteins
Protein aggregation during refoldingOptimize refolding protocolsEmploy step-wise temperature reduction and chaperone assistance

When designing functional assays, it's essential to account for the natural operating temperature of P. furiosus (near 100°C) while adapting protocols to laboratory conditions .

How can researchers optimize heterologous expression of P. furiosus SecF to maximize yield and maintain native conformation?

Optimization of heterologous expression of P. furiosus SecF requires attention to several parameters:

  • Expression strain selection: While Rosetta 2(DE3)pLysS has proven effective for many P. furiosus proteins, alternative strains like C41(DE3) or C43(DE3) designed for membrane proteins should be considered for SecF.

  • Induction conditions optimization:

    • Test IPTG concentrations ranging from 0.1 mM to 1 mM

    • Evaluate induction temperatures from 18°C to 37°C

    • Consider extended expression times (6-24 hours) at lower temperatures

  • Solubility enhancement strategies:

    • Co-expression with chaperones like GroEL/GroES

    • Fusion with solubility tags (MBP, SUMO, or TrxA)

    • Addition of compatible solutes in growth media

  • Membrane protein extraction:

    • Optimize detergent selection (DDM, LDAO, or Triton X-100)

    • Implement sequential extraction protocols

    • Consider nanodiscs for maintaining native conformation

Systematic optimization using design of experiments (DoE) approach would allow efficient identification of optimal expression conditions while minimizing experimental runs .

What are the recommended approaches for structural characterization of P. furiosus SecF, considering its membrane-associated nature?

Structural characterization of membrane-associated P. furiosus SecF presents unique challenges requiring specialized approaches:

  • Cryo-electron microscopy (cryo-EM):

    • Particularly suitable for membrane proteins

    • Sample preparation in nanodiscs or amphipols to maintain native environment

    • High-resolution structures possible without crystallization

  • X-ray crystallography:

    • Requires detergent screening for crystallization

    • Lipidic cubic phase crystallization may better mimic membrane environment

    • Consider fusion with crystallization chaperones (e.g., T4 lysozyme)

  • NMR spectroscopy:

    • Solution NMR for dynamic regions (loops, termini)

    • Solid-state NMR for transmembrane regions

    • Requires isotopic labeling (13C, 15N) during recombinant expression

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Provides information on protein dynamics and solvent accessibility

    • Useful for mapping interaction interfaces with other Sec components

    • Compatible with detergent-solubilized proteins

  • Molecular dynamics simulations:

    • Complement experimental approaches

    • Model protein behavior in membrane environments

    • Predict conformational changes during protein translocation

When designing structural biology experiments, researchers should consider the thermostable nature of P. furiosus SecF, which may allow data collection at elevated temperatures not possible with mesophilic proteins .

How can researchers distinguish between the functional roles of SecF and other Sec pathway components in P. furiosus?

To distinguish the specific functional roles of SecF from other Sec pathway components in P. furiosus, researchers should implement a multi-faceted approach:

  • Reconstitution experiments with purified components:

    • Systematic omission of individual Sec components

    • Step-wise addition of components to identify minimal functional units

    • Cross-species complementation with homologous proteins

  • Site-directed mutagenesis studies:

    • Target conserved residues in SecF

    • Modify predicted interaction interfaces

    • Engineer conditional mutants

  • In vitro protein translocation assays:

    • Develop thermostable translocation substrates

    • Measure translocation efficiency using protease protection assays

    • Quantify ATP and PMF dependencies for different Sec components

  • Protein-protein interaction mapping:

    • Cross-linking coupled with mass spectrometry

    • Microscale thermophoresis for binding affinities

    • Surface plasmon resonance at elevated temperatures

  • Comparative genomics and evolution:

    • Analyze SecF conservation across archaeal species

    • Compare archaeal SecF with bacterial and eukaryotic homologs

    • Identify co-evolving residues with other Sec components

These approaches should be conducted under conditions that mimic the native P. furiosus environment, including consideration of the optimal growth temperature near 100°C .

What bioinformatic approaches can help predict substrate specificity and interaction partners of P. furiosus SecF?

Advanced bioinformatic approaches can provide valuable insights into substrate specificity and interaction partners of P. furiosus SecF:

  • Homology modeling and threading:

    • Build structural models based on homologous proteins

    • Predict transmembrane topology and orientation

    • Identify potential substrate-binding regions

  • Molecular docking simulations:

    • Model interactions with other Sec components

    • Predict substrate binding modes

    • Evaluate the impact of mutations on complex formation

  • Coevolution analysis:

    • Direct coupling analysis to identify co-evolving residue pairs

    • Predict interaction surfaces between SecF and partner proteins

    • Identify evolutionarily conserved functional motifs

  • Machine learning approaches:

    • Train models to predict Sec-dependent substrates

    • Identify signal sequence patterns specific to P. furiosus

    • Compare with known archaeal secretome data

  • Network analysis:

    • Construct protein-protein interaction networks

    • Identify functional modules within the secretion machinery

    • Compare with other archaeal and bacterial systems

These computational approaches should be validated experimentally but can significantly guide experimental design and hypothesis generation .

What are the critical controls required when working with recombinant P. furiosus SecF in functional assays?

When designing experiments with recombinant P. furiosus SecF, the following controls are essential:

  • Negative controls:

    • Heat-inactivated SecF protein

    • Non-functional mutants (e.g., conserved residue mutations)

    • Omission of essential components (ATP, membrane vesicles)

  • Positive controls:

    • Well-characterized SecF from model organisms

    • Known substrates of the Sec pathway

    • Reconstituted complete Sec system

  • Specificity controls:

    • Non-Sec substrates

    • Competitive inhibition assays

    • Cross-pathway substrates

  • Technical controls:

    • Temperature stability verification

    • Detergent effect controls

    • Buffer composition controls

  • Validation approaches:

    • Orthogonal assay methods

    • In vivo complementation studies

    • Structure-based validation of interactions

These controls help distinguish specific SecF-dependent effects from non-specific or artifact effects and ensure experimental reproducibility .

How should researchers approach contradictory data when comparing P. furiosus SecF to bacterial homologs?

When encountering contradictory data between P. furiosus SecF and bacterial homologs, researchers should:

  • Evaluate experimental conditions:

    • Consider temperature differences (P. furiosus optimal growth ~100°C vs. bacteria at 37°C)

    • Examine buffer compositions and membrane environments

    • Assess protein preparation methods

  • Address structural divergence:

    • Compare sequence conservation in functional domains

    • Analyze structural differences through homology modeling

    • Consider archaeal-specific adaptations

  • Reconciliation strategies:

    • Design hybrid proteins with domain swapping

    • Test function across temperature ranges

    • Examine evolutionary conservation patterns

  • Systematic comparison approach:

    • Create a comparison matrix of properties and functions

    • Weight evidence based on methodological strength

    • Consider evolutionary distance in interpretations

  • Additional validation:

    • Perform in vivo studies when possible

    • Use orthogonal techniques to validate findings

    • Consider collaborations with specialists in both systems

The phylogenetic distance between archaea and bacteria means that functional divergence is expected, even in conserved systems like protein translocation .

What statistical approaches are recommended for analyzing kinetic data from P. furiosus SecF translocation assays?

When analyzing kinetic data from P. furiosus SecF translocation assays, researchers should implement:

  • Model selection:

    • Evaluate multiple kinetic models (Michaelis-Menten, Hill, etc.)

    • Use Akaike Information Criterion (AIC) to select optimal models

    • Consider temperature-dependent parameters in models

  • Temperature correction factors:

    • Apply Arrhenius equations for temperature scaling

    • Compare kinetics across temperature ranges

    • Establish standardized reference temperatures

  • Statistical tests and validation:

    • Use non-parametric tests when distributions are unknown

    • Implement bootstrap resampling for robust parameter estimation

    • Perform sensitivity analysis for key parameters

  • Comparative analysis framework:

    • Standardize comparison metrics across different substrates

    • Normalize data to account for protein stability differences

    • Implement hierarchical statistical models for nested data

  • Data visualization approaches:

    • Create Arrhenius plots to visualize temperature dependencies

    • Use residual plots to identify systematic deviations

    • Implement heat maps for multi-parameter comparisons

When reporting statistical analysis, researchers should explicitly state all assumptions, transformations, and models used to ensure reproducibility .

How can researchers effectively design experiments to elucidate the energy coupling mechanism of P. furiosus SecF?

To investigate the energy coupling mechanism of P. furiosus SecF, researchers should design experiments that:

  • Decouple energy sources:

    • Selective disruption of proton motive force (PMF) using ionophores

    • ATP depletion systems to isolate PMF-dependent steps

    • Creation of artificial gradients in reconstituted systems

  • Site-directed mutagenesis targets:

    • Conserved charged residues in transmembrane regions

    • Potential proton-binding sites

    • ATP-binding domains of partner proteins

  • Bioenergetic measurements:

    • Real-time monitoring of proton translocation

    • Membrane potential measurements at elevated temperatures

    • Correlation of translocation activity with PMF magnitude

  • Conformational dynamics studies:

    • FRET-based approaches to monitor conformational changes

    • Distance measurements between key domains

    • Time-resolved structural transitions during energy utilization

  • Experimental design matrix:

Variable ParameterMeasurementControl ConditionInterpretation
ΔpHTranslocation efficiencyCollapsed gradientPMF dependency
Membrane potentialATPase activityDepolarized membraneElectrogenic steps
TemperatureEnergy coupling efficiencyReference temperatureThermodynamic optimization
Ion gradientsSubstrate movementIon substitutionIon specificity
ATP concentrationConformational statesNon-hydrolyzable ATPEnergy transduction mechanism

What emerging technologies might advance our understanding of P. furiosus SecF structure and function?

Several cutting-edge technologies hold promise for advancing our understanding of P. furiosus SecF:

  • AlphaFold and deep learning approaches:

    • Predict protein structures with increasing accuracy

    • Model protein-protein interactions within the Sec system

    • Generate hypotheses about functional mechanisms

  • Single-molecule techniques:

    • Optical tweezers to measure force generation during translocation

    • Single-molecule FRET to monitor conformational dynamics

    • Nanopore recordings of substrate translocation events

  • Advanced imaging technologies:

    • High-speed atomic force microscopy to visualize dynamics

    • Super-resolution microscopy for in vivo localization

    • Correlative light and electron microscopy approaches

  • Time-resolved structural methods:

    • Time-resolved cryo-EM for capturing intermediate states

    • X-ray free-electron laser (XFEL) studies for dynamic changes

    • Temperature-jump coupled spectroscopy for conformational transitions

  • Synthetic biology approaches:

    • Minimal Sec systems with defined components

    • Orthogonal translation systems for in vivo studies

    • Engineering chimeric systems to test specific hypotheses

These technologies, especially when combined in integrated approaches, can provide unprecedented insights into the molecular mechanisms of P. furiosus SecF .

How might insights from P. furiosus SecF contribute to our understanding of protein translocation systems across domains of life?

Research on P. furiosus SecF can contribute to broader understanding of protein translocation across domains of life through:

  • Evolutionary perspectives:

    • Archaea represent a distinct evolutionary lineage

    • Identification of conserved vs. domain-specific mechanisms

    • Insights into the ancestral protein translocation machinery

  • Extreme condition adaptations:

    • Principles of thermostable protein translocation machinery

    • Flexibility vs. rigidity trade-offs in different environments

    • Energy efficiency mechanisms at extreme temperatures

  • Minimal system requirements:

    • Identification of essential components across domains

    • Fundamental biophysical principles governing translocation

    • Core mechanisms preserved throughout evolution

  • Biotechnological applications:

    • Engineering thermostable secretion systems

    • Development of robust protein production platforms

    • Design principles for synthetic translocation systems

  • Medical and pharmaceutical relevance:

    • Sec pathway as an antimicrobial target

    • Understanding disease-related translocation defects

    • Development of protein secretion technologies for therapeutics

By studying protein translocation in extremophiles like P. furiosus, researchers gain unique perspectives on fundamental biological processes that complement studies in model organisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.