Recombinant Pyrococcus furiosus UPF0290 protein PF0398 (PF0398)

Shipped with Ice Packs
In Stock

Description

Expression and Production

PF0398 is produced via recombinant expression in E. coli, leveraging ligase-independent cloning methods for high-throughput production . Key steps include:

  • Cloning: PCR amplification of the PF0398 gene using phosphorothioate-modified primers, followed by λ exonuclease digestion .

  • Expression Host: E. coli Rosetta 2(DE3)pLysS for optimal recombinant protein yield .

  • Purification: Affinity chromatography via the His-tag, yielding >85% purity as confirmed by SDS-PAGE .

ParameterDetails
Induction MethodIsopropyl β-D-1-thiogalactopyranoside (IPTG) at 0.5 mM
Expression Temperature37°C
Yield~50 µg per batch (commercial products)

Functional Studies and Hypothetical Roles

PF0398 is annotated as a hypothetical protein with no confirmed biological function. Its classification as UPF0290 suggests it belongs to a conserved but uncharacterized gene family across archaea . Potential roles inferred from sequence analysis include:

  • Structural Function: Possible involvement in cellular membranes or protein complexes, given its transmembrane nature .

  • Thermotolerance: Likely contributes to P. furiosus’s adaptation to 100°C environments, as seen in other archaeal proteins .

No direct functional studies (e.g., enzymatic assays or knockout experiments) have been reported for PF0398. Further structural and biochemical analyses are required to elucidate its role.

Applications in Research and Biotechnology

PF0398 serves as a research tool in structural genomics and biotechnology:

  • Structural Studies: Used to explore novel protein folds in P. furiosus .

  • ELISA and Antibody Development: Commercial recombinant PF0398 is employed in immunoassays to study archaeal protein interactions .

  • Thermostable Enzyme Libraries: Part of efforts to develop industrial enzymes (e.g., DNA polymerases) for high-temperature processes .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
carS; PF0398; CDP-archaeol synthase; CDP-2,3-bis-(O-geranylgeranyl-sn-glycerol synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Target Names
carS
Target Protein Sequence
MHPILEAFWYILPAYFANSSPVILGGGTPIDFGKTWRDGRRIFGDSKTWRGFLGGLTVGT LIGVIQQIIYPYYPSLSLAFKVSFLLALGALVGDLIGSFIKRRLNLPPGYPAVGLDQWGF LISALCFAYPVHTIPTGEVLLLLVVTPLIHWGTNVLAYKMKWKSVPW
Uniprot No.

Target Background

Function
This enzyme catalyzes the formation of CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol (CDP-archaeol) from 2,3-bis-(O-geranylgeranyl)-sn-glycerol 1-phosphate (DGGGP) and CTP. This reaction represents the third ether-bond-formation step in the biosynthesis of archaeal membrane lipids.
Database Links

KEGG: pfu:PF0398

STRING: 186497.PF0398

Protein Families
CDP-archaeol synthase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How is PF0398 typically expressed and purified for research applications?

For research applications, PF0398 is typically expressed using an E. coli expression system with the following methodology:

  • Cloning approach: The gene encoding PF0398 is amplified from P. furiosus chromosomal DNA by PCR and cloned into an expression vector (such as pET series vectors) .

  • Expression system: The construct is typically transformed into E. coli Rosetta 2(DE3)pLysS or similar expression hosts that can accommodate rare codons often found in archaeal proteins .

  • Expression conditions:

    • Culture is grown in LB or auto-induction media (ZYP-5052) at 37°C until reaching appropriate density

    • Protein expression is induced with IPTG (0.5 mM) for 3-4 hours at 37°C

    • For membrane proteins like PF0398, lower temperatures (16-30°C) during induction may improve folding

  • Purification process:

    • Cells are harvested by centrifugation and lysed by sonication or French press

    • Membrane fraction is isolated by ultracentrifugation

    • The protein is solubilized using appropriate detergents

    • Affinity chromatography using His-tag (N-terminal 10xHis-tagged) is performed

    • Further purification by ion-exchange and size-exclusion chromatography

  • Quality assessment: SDS-PAGE, mass spectrometry, and western blotting are used to confirm protein identity and purity .

Research has shown that the expression of P. furiosus proteins in E. coli systems can achieve success rates of approximately 69% (55 out of 80 genes tested), with membrane proteins like PF0398 typically requiring more optimization than soluble proteins .

What computational methods can be used to predict the structure and function of PF0398?

Several computational approaches can be employed to predict the structure and function of PF0398:

  • Sequence-based predictions:

    • Pfeature software package can compute over 50,000 features for predicting protein function using compositional features like amino acid composition, dipeptide composition, and atomic composition

    • Shannon entropy calculations can be used to analyze sequence complexity and conservation patterns

    • Physicochemical property analysis using standardized indices (hydrophobicity, charge, etc.)

  • Structure prediction methods:

    • ESMFold can provide high-accuracy, end-to-end atomic-level structure prediction using only the protein sequence as input (particularly valuable for proteins like PF0398 that may lack experimental structures)

    • AlphaFold2 and RoseTTAFold can provide complementary structural predictions, especially when using multiple sequence alignments

  • Comparative analysis workflow:

    • Search for structural homologs using TM-score calculations against the PDB database

    • Calculate metrics like perplexity score to evaluate confidence in structural predictions

    • Identify potential structural motifs shared with functionally characterized proteins

  • Function prediction pipeline:

    • Analysis of conserved domains and motifs

    • Comparison with characterized membrane proteins from other extremophiles

    • Integration of structural predictions with membrane topology models

The research by Lin et al. demonstrates that language models like ESM-2 can effectively learn protein structure information from sequence alone, allowing for accurate structure prediction of proteins like PF0398 even in the absence of experimental structures or close homologs .

What experimental approaches are most effective for determining the structure of membrane proteins like PF0398?

Determining the structure of membrane proteins like PF0398 remains challenging but several effective experimental approaches include:

  • X-ray crystallography:

    • Sample preparation: Purify protein in detergent micelles or lipidic cubic phase

    • Crystallization: Screen various conditions using sparse matrix approaches

    • Data collection: Collect diffraction data at synchrotron sources using cryogenic temperatures (100K)

    • Structure determination: Phase determination using selenium-methionine labeling or heavy atom derivatives (KI, K₂PtCl₄, or KAu(CN)₂)

  • Cryo-electron microscopy:

    • Sample preparation: Vitrification of purified protein in detergent or reconstituted into nanodiscs

    • Data collection: Collection of thousands of particle images using direct electron detectors

    • Image processing: 2D classification followed by 3D reconstruction

    • Model building: De novo model building guided by secondary structure predictions

  • NMR spectroscopy (for smaller membrane proteins or domains):

    • Sample preparation: ¹⁵N/¹³C isotope labeling of the protein

    • Solubilization: Use of detergent micelles or bicelles

    • Data collection: Multidimensional NMR experiments

    • Structure calculation: NOE-derived distance restraints and dihedral angle restraints

  • Integrated structural biology approach:

    • Combine lower-resolution data (SAXS, cross-linking mass spectrometry)

    • Incorporate computational predictions from ESMFold or AlphaFold2

    • Validate using biochemical and biophysical techniques

Table 1: Comparison of Structural Determination Methods for Membrane Proteins

MethodResolution RangeAdvantagesLimitationsSample Requirements
X-ray Crystallography1.5-3.5 ÅHigh resolution, well-establishedRequires crystals5-10 mg of pure protein
Cryo-EM2.5-4.0 ÅNo crystals needed, native environmentLower resolution for small proteins1-5 mg of pure protein
NMRAtomic resolutionSolution dynamics, no crystalsSize limitation (<30 kDa)5-20 mg isotope-labeled
Computational (ESMFold)2.5-5.0 Å (predicted)Sequence only input, rapidRequires validationSequence only

For PF0398 specifically, a combined approach starting with computational structure prediction (ESMFold) followed by experimental validation using cryo-EM or X-ray crystallography would be most effective given its membrane protein nature and size .

How can researchers optimize expression conditions for PF0398 in E. coli systems?

Optimizing expression of PF0398 in E. coli requires systematic testing of multiple parameters:

  • Vector selection and construct design:

    • Use vectors with strong, inducible promoters (T7, tac)

    • Consider codon optimization for E. coli expression

    • Test different fusion tags (His, GST, MBP) for enhanced solubility

    • Include sequence-verified clones with ≥80% positive clone percentage

  • Host strain selection:

    • Rosetta 2(DE3)pLysS for rare codon supplementation

    • C41/C43(DE3) for membrane protein expression

    • SHuffle/Origami for disulfide bond formation if needed

  • Culture conditions optimization:

    • Media composition (LB, TB, auto-induction media)

    • Temperature (typically lower for membrane proteins: 18-30°C)

    • Inducer concentration (0.01-1.0 mM IPTG)

    • Induction time (3 hours to overnight)

    • Cell density at induction (OD₆₀₀ 0.6-1.0)

  • Systematic optimization approach:

    • Initial small-scale expression tests (10-50 mL)

    • Analysis by SDS-PAGE and western blot

    • Scale-up of optimized conditions

  • Expression monitoring:

    • Check both soluble and membrane fractions

    • Assess protein quality by SDS-PAGE and mass spectrometry

    • Confirm function with activity assays

Table 2: Optimization Parameters for PF0398 Expression in E. coli

ParameterVariables to TestAnalytical MethodSuccess Criteria
E. coli strainBL21(DE3), Rosetta 2(DE3)pLysS, C43(DE3)SDS-PAGE, Western blotBand at expected MW (~18-20 kDa)
Induction temperature18°C, 25°C, 30°C, 37°CSDS-PAGE, Membrane fraction analysisProtein in membrane fraction
IPTG concentration0.1 mM, 0.5 mM, 1.0 mMSDS-PAGE, Activity assayActive protein yield
Induction time3h, 6h, overnightTime-course SDS-PAGEOptimal expression time point
Media compositionLB, TB, ZYP-5052 auto-inductionCell density, Protein yieldMaximum yield of functional protein

What methods can be used to investigate protein-membrane interactions of PF0398?

As a membrane protein, understanding PF0398's interaction with lipid membranes is crucial:

  • Membrane reconstitution approaches:

    • Reconstitution into liposomes using archaeal-like lipids

    • Incorporation into nanodiscs for controlled membrane environment

    • Bicelle reconstitution for spectroscopic studies

  • Biophysical characterization methods:

    • Attenuated total reflection Fourier transform infrared spectroscopy (ATR-FTIR)

    • Solid-state NMR spectroscopy for orientation and dynamics

    • Surface plasmon resonance (SPR) for binding kinetics

    • Fluorescence spectroscopy with labeled protein or lipids

  • Molecular dynamics simulation strategies:

    • Coarse-grained simulations for longer timescales

    • All-atom simulations for detailed interactions

    • Analysis of protein stability in different membrane compositions

    • Free energy calculations for membrane insertion

  • Experimental design considerations:

    • Test different lipid compositions (archaeal vs. bacterial)

    • Examine effects of temperature on membrane interactions

    • Investigate pH and salt concentration effects

    • Use blocking groups to identify key interaction sites

  • Topology mapping experiments:

    • Cysteine accessibility methods

    • Protease protection assays

    • Fluorescence quenching studies

    • EPR spectroscopy with site-directed spin labeling

Table 3: Methods for Studying Protein-Membrane Interactions of PF0398

MethodInformation ObtainedAdvantagesTechnical Considerations
ATR-FTIRSecondary structure in membraneLabel-free, directRequires concentrated samples
Solid-state NMROrientation, dynamicsAtomic resolutionRequires isotope labeling
Nanodisc reconstitutionControlled membrane environmentDefined stoichiometryComplex preparation
MD simulationsDynamics, energeticsAtomic-level detailComputational resources
EPR spectroscopyDistance measurements, dynamicsSensitive, selectiveRequires spin labeling

A comprehensive experimental approach would combine these methods in a systematic way:

  • Predict membrane-interacting regions using computational tools

  • Reconstitute PF0398 into archaeal-like liposomes

  • Perform topology mapping using multiple complementary techniques

  • Validate findings using molecular dynamics simulations

  • Compare results with structural predictions from ESMFold or similar tools

What computational approaches are most effective for predicting functional partners of PF0398?

Predicting functional partners of PF0398 requires sophisticated computational approaches:

  • Genomic context analysis:

    • Gene neighborhood analysis in P. furiosus genome

    • Comparative genomics across Thermococcales species

    • Operon structure prediction and synteny analysis

    • Phylogenetic profiling to identify co-occurring genes

  • Protein-protein interaction prediction:

    • Structural docking using predicted PF0398 structure from ESMFold

    • Interface prediction based on conservation patterns

    • Coevolution analysis to identify correlated mutations

    • Machine learning-based PPI prediction methods

  • Functional association networks:

    • Integration of multiple data sources (co-expression, text mining)

    • Network analysis to identify functional modules

    • Pathway enrichment analysis of predicted partners

    • Cross-species comparison of interaction networks

  • Experimental validation design:

    • Plan co-immunoprecipitation experiments

    • Design bacterial/yeast two-hybrid assays adapted for thermophilic proteins

    • Develop FRET-based interaction assays compatible with high temperatures

    • Apply protein crosslinking and mass spectrometry approaches

  • Methodological considerations:

    • Account for the thermophilic nature of protein interactions

    • Consider membrane localization in interaction predictions

    • Use appropriate null models and statistical thresholds

    • Validate predictions with available experimental data

The predicted interactions could be represented in a network visualization with confidence scores and functional classifications, and prioritized for experimental validation based on multiple lines of evidence.

The development of ESMFold and similar large language models of protein sequences represents a significant advancement for studying proteins like PF0398, as they can predict structural features directly from sequence information even when experimental structures or close homologs are unavailable .

What are the common challenges in expressing and purifying PF0398, and how can they be addressed?

Researchers commonly encounter several challenges when working with PF0398:

  • Expression challenges and solutions:

    • Problem: Low expression levels
      Solution: Optimize codon usage, test different E. coli strains like Rosetta 2(DE3)pLysS, C41/C43, or BL21-AI

    • Problem: Protein misfolding and aggregation
      Solution: Lower induction temperature (16-25°C), use specialized strains for membrane proteins, test fusion tags like MBP

    • Problem: Toxicity to host cells
      Solution: Use tight expression control (pLysS strains), test auto-induction media, use lower IPTG concentrations

  • Purification challenges and solutions:

    • Problem: Poor solubilization
      Solution: Screen different detergents (DDM, LDAO, Triton X-100), test solubilization conditions (time, temperature)

    • Problem: Low binding to affinity resins
      Solution: Optimize tag position (N vs C-terminal), test different affinity tags, adjust binding buffer conditions

    • Problem: Contaminants in purified fraction
      Solution: Add additional purification steps (ion exchange, size exclusion), optimize washing steps

  • Activity preservation challenges:

    • Problem: Loss of activity during purification
      Solution: Include stabilizing agents (glycerol, specific lipids), minimize time at room temperature

    • Problem: Difficulties in activity measurement
      Solution: Develop assays compatible with detergent-solubilized protein, consider reconstitution before activity testing

  • Experimental design approaches:

    • Use factorial design to systematically test expression parameters

    • Implement Latin square design to optimize purification conditions

    • Apply response surface methodology to find optimal conditions

Table 4: Troubleshooting Guide for PF0398 Expression and Purification

ChallengeDiagnostic SignsPotential SolutionsSuccess Indicators
Low expressionFaint/no band at expected MWChange vector, strain, decrease temperatureVisible band on SDS-PAGE
Protein in inclusion bodiesProtein in insoluble fractionLower temperature, add solubilizing tagsProtein in soluble/membrane fraction
Poor membrane extractionLow yield after membrane prepTest different detergents, longer solubilizationIncreased protein in solubilized fraction
Protein aggregationElution in void volume in SECAdd stabilizing agents, optimize bufferMonodisperse peak in SEC
Loss of activityLow/no enzymatic activityInclude cofactors, optimize storageDetectable enzyme activity

Based on experiences with P. furiosus proteins, approximately 69% of proteins can be successfully expressed in E. coli systems with optimization, though membrane proteins like PF0398 typically require more extensive optimization .

How can researchers address the challenge of studying a protein from a hyperthermophilic organism using conventional laboratory techniques?

Studying proteins from hyperthermophiles like P. furiosus presents unique challenges:

  • Temperature-related challenges:

    • Problem: Standard equipment limited to <100°C
      Solution: Use pressure vessels for reactions above 100°C, specialized high-temperature incubators

    • Problem: Buffer instability at high temperatures
      Solution: Use thermostable buffers (HEPES, phosphate at higher concentrations), add stabilizing agents

    • Problem: Enzyme assay components unstable at high temperatures
      Solution: Develop modified assays with thermostable components, use coupled enzyme systems from thermophiles

  • Structural analysis adaptations:

    • Problem: Protein crystallization typically performed at 4-25°C
      Solution: Try crystallization at elevated temperatures, use computational structure prediction (ESMFold)

    • Problem: Conventional structural techniques limited to ambient temperatures
      Solution: Use computational modeling, adapt methods for high-temperature measurements, analyze quenched samples

  • Activity measurement challenges:

    • Problem: Optimal activity at temperatures challenging to measure
      Solution: Develop specialized equipment, use indirect assays, extrapolate from lower temperature measurements

    • Problem: Rapid reactions at high temperatures
      Solution: Use quench-flow apparatus, develop real-time monitoring, use temperature jumps

  • Experimental design considerations:

    • Include temperature as a key variable in factorial designs

    • Use appropriate controls at various temperatures

    • Consider thermal gradients in reaction vessels

    • Implement statistical methods to model temperature effects

  • Practical adaptations:

    • Modify laboratory equipment for high-temperature operation

    • Develop specialized reaction vessels

    • Use computational approaches to complement experimental limitations

    • Collaborate with specialized facilities for high-temperature experiments

Researchers studying PF0398 can adapt conventional techniques by:

  • Conducting initial characterization at moderate temperatures (60-80°C)

  • Extrapolating to higher temperatures using Arrhenius plots

  • Utilizing computational predictions to guide experimental design

  • Employing specialized equipment for critical high-temperature measurements

  • Developing appropriate controls to account for temperature effects on assay components

These adaptations allow researchers to overcome the inherent challenges of studying hyperthermophilic proteins while obtaining reliable and relevant data about their structure and function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.