Recombinant Pyrococcus horikoshii Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Cobalamin Synthase (CobS) Function

CobS catalyzes the final steps of cobalamin biosynthesis, attaching the nucleotide loop to adenosylcobinamide (AdoCbi) to form adenosylcobalamin (AdoCbl). This process involves:

  • Substrate specificity: CobS binds adenosylated cobamides and α-ribazole derivatives .

  • Phosphorylation: CobS synthesizes AdoCbl-5′-phosphate, which is later dephosphorylated by CobC to yield active AdoCbl .

Salmonella typhimurium CobS

  • Activity: Converts AdoCbi-GDP and α-ribazole-5′-P to AdoCbl-5′-P with a specific activity of 8–22 nmol/min/mg protein .

  • Kinetics: Requires no additional cofactors beyond substrates, operating efficiently under anaerobic conditions .

Pseudomonas denitrificans Pathway

  • Aerobic synthesis: CobS functions in oxygen-dependent cobalt insertion and nucleotide loop assembly .

Recombinant Enzyme Expression in Pyrococcus horikoshii

While P. horikoshii CobS has not been explicitly studied, the organism’s hyperthermophilic enzymes (e.g., glutamate decarboxylase, tRNA ligase) have been successfully expressed in E. coli . Key features of recombinant P. horikoshii systems include:

  • Thermostability: Enzymes retain activity at 60–95°C .

  • Surface display: Outer membrane protein C (OmpC) fusion systems enhance extracellular catalytic efficiency .

Comparative Activity Table: CobS Homologs

OrganismSpecific Activity (nmol/min/mg)Cofactor RequirementTemperature OptimumReference
S. typhimurium8–22None37°C
P. denitrificansNot reportedO2-dependent30°C
P. horikoshii (predicted)Anaerobic95°C

Biotechnological Applications

  • Cobamide engineering: Structural variations in cobamide lower ligands (e.g., benzimidazole vs. purine) influence CobS binding affinity and catalytic efficiency .

  • High-temperature catalysis: Recombinant P. horikoshii enzymes are ideal for industrial processes requiring thermostability, such as vitamin B12 production .

Research Gaps and Future Directions

  • Direct characterization: No studies have purified or assayed P. horikoshii CobS.

  • Cobamide selectivity: Structural analysis of the enzyme’s lower-ligand binding pocket could inform synthetic biology applications .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; PH0373; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Target Names
cobS
Target Protein Sequence
MKNILPFLTRIPIKGDFEKARRELWAFPLVSVFTSPLPALILYLKVPLASILALLSLYFT IGLLHLDGLADWADGIMVKGDREKKIKAMKDINVGVAGIFAVVTVLMLQIYSLQLVPFYA IFLAELNSKFAMLLAMATKKPLGKGLGAYFMEALDRNQLLYGTLIYLLLYIPVIIAEPRN LVSFLGLFIGLYAVKISLDNFGGLNGDCIGAVAEITRVGTLVVITLGWRI
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) from *Pyrococcus horikoshii* catalyzes the final two steps in the biosynthesis of cobalamin (vitamin B12). It joins adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links

KEGG: pho:PH0373

STRING: 70601.PH0373

Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Pyrococcus horikoshii Cobalamin synthase (cobS) and what is its role in cobalamin biosynthesis?

Pyrococcus horikoshii Cobalamin synthase (cobS) is a key enzyme in the anaerobic pathway of vitamin B12 (cobalamin) biosynthesis. This enzyme catalyzes one of the final steps in cobalamin assembly, specifically the incorporation of cobalt into the corrin ring structure. As a thermostable enzyme from the hyperthermophilic archaeon Pyrococcus horikoshii, cobS functions optimally at high temperatures, typically between 70-100°C, reflecting the extreme environmental conditions of its native organism.

Like other enzymes involved in cobalamin biosynthesis, cobS plays a crucial role in producing this essential cofactor required for various methyltransferases and isomerases across many organisms. The enzyme's function is particularly important in the context of understanding archaeal adaptation to extreme environments and the evolution of vitamin B12 biosynthesis pathways .

What expression systems are most effective for recombinant production of Pyrococcus horikoshii Cobalamin synthase?

Escherichia coli remains the most widely used expression system for recombinant production of Pyrococcus horikoshii Cobalamin synthase. Specifically, E. coli BL21(DE3) strains are preferred due to their reduced protease activity and efficient T7 RNA polymerase-based expression system. For thermostable enzymes like those from P. horikoshii, the pET vector system (particularly pET28a) offers high expression levels under IPTG induction .

When expressing hyperthermophilic proteins, consider these methodological approaches:

  • Use E. coli strains designed for expressing toxic or difficult proteins, such as BL21(DE3)pLysS, which provides tighter control of basal expression

  • Employ a vector containing a His-tag for simplified purification, similar to the approach used for other recombinant thermostable enzymes

  • Consider co-expression with chaperones if initial expression yields insoluble protein

  • Optimize induction conditions, testing different IPTG concentrations (typically 0.1-1.0 mM), induction temperatures (often lowered to 25-30°C to improve solubility), and induction times (4-16 hours)

What are the optimal conditions for purification of recombinant Pyrococcus horikoshii Cobalamin synthase?

Purification of recombinant P. horikoshii Cobalamin synthase typically employs a multi-step approach leveraging the enzyme's thermostability and affinity tags. Based on protocols for similar thermostable enzymes, the following methodological approach is recommended:

  • Initial heat treatment (70-80°C for 15-30 minutes) to precipitate most E. coli host proteins while keeping the thermostable target protein soluble

  • Nickel-affinity chromatography for His-tagged proteins using buffer conditions such as:

    • Equilibration/binding buffer: 50 mM Tris-HCl, 10% glycerol, 0.5 M NaCl, pH 8.0 with 10-20 mM imidazole

    • Washing buffer: Same as binding buffer but with 20-50 mM imidazole

    • Elution buffer: Same base buffer with 100-250 mM imidazole

  • For higher purity, employ ion-exchange chromatography as a secondary step

  • Desalt and concentrate the purified protein using ultrafiltration devices (e.g., Vivaspin)

  • Store the enzyme with glycerol (10-20%) at 4°C for short-term or -80°C for long-term storage

How can I verify the activity of purified recombinant Cobalamin synthase?

Verifying the activity of purified recombinant Cobalamin synthase requires specialized assays that detect either substrate consumption or product formation. A typical activity assay would include:

  • Reaction mixture containing:

    • Appropriate cobalt source (typically cobalt chloride)

    • Hydrogenobyrinic acid a,c-diamide (substrate)

    • ATP as energy source

    • Reducing agent (typically DTT or β-mercaptoethanol)

    • Buffer system (often Tris-HCl at pH 8.0-9.0 for thermostable enzymes)

  • Incubation at the enzyme's optimal temperature (typically 70-80°C for P. horikoshii enzymes)

  • Analysis methods:

    • HPLC analysis of reaction products with UV-visible detection

    • Spectrophotometric assays (similar to those for PLP synthase) measuring absorbance changes associated with product formation

    • Colorimetric assays where the product forms colored complexes with specific reagents

For quantification, establish a standard curve using authentic cobalamin standards at various concentrations. One unit of enzyme activity is typically defined as the amount of enzyme required to produce 1 nmol of product per minute under defined conditions .

What structural features determine substrate recognition in Pyrococcus horikoshii Cobalamin synthase?

Substrate recognition in P. horikoshii Cobalamin synthase involves complex molecular interactions that determine its specificity. Though specific structural data for P. horikoshii cobS is limited, insights can be drawn from studies of related cobamide-binding enzymes.

Key structural determinants likely include:

  • Active site architecture with specific binding pockets for:

    • The corrin ring structure

    • The nucleotide loop

    • The lower ligand coordination site

  • Binding site residues that form specific interactions with the substrate:

    • Hydrogen bonding networks

    • Hydrophobic interactions

    • Electrostatic interactions

Studies on Methylmalonyl Coenzyme A Mutase (MCM) demonstrate how changes in the lower ligand structure of cobamides significantly impact binding affinity, with equilibrium dissociation constants (Kd) varying by orders of magnitude depending on the specific benzimidazolyl or purinyl bases present . Similar specificity may exist in cobS, particularly in recognizing precursor molecules during cobalamin synthesis.

The binding mechanism likely involves initial complex formation before displacement of the lower ligand by a histidine residue in the protein, as observed in other cobamide-binding enzymes . This multi-step binding process creates opportunities for structural features of the substrate to impact binding outcomes.

How does temperature affect the activity and stability of recombinant Pyrococcus horikoshii Cobalamin synthase?

The thermostability and temperature-activity relationship of P. horikoshii Cobalamin synthase reflects its hyperthermophilic origin. Based on studies of other P. horikoshii enzymes and similar thermostable proteins:

  • Temperature-activity profile:

    • Minimal activity at mesophilic temperatures (<40°C)

    • Rapidly increasing activity between 50-70°C

    • Optimal activity typically between 70-90°C

    • Activity decline above 90-100°C

  • Thermostability characteristics:

    • Maintaining >50% activity after prolonged incubation (hours) at 70-80°C

    • Half-life at 95°C typically exceeding 1-2 hours

    • Possible resistance to denaturants at elevated temperatures

The molecular basis for this thermostability likely includes:

  • Increased number of salt bridges and hydrogen bonds

  • Higher proportion of hydrophobic residues in the core

  • Compactness of structure with fewer surface loops

  • Possible disulfide bonds stabilizing tertiary structure

When working with this enzyme, preheating buffers and reaction components is recommended to achieve optimal activity measurements. Temperature control during assays is critical, as even small temperature fluctuations can significantly impact reaction rates .

What cofactors are essential for Pyrococcus horikoshii Cobalamin synthase activity?

Pyrococcus horikoshii Cobalamin synthase requires specific cofactors for optimal activity, reflecting the complex chemistry involved in cobalt incorporation:

  • ATP: Essential energy source for the reaction, likely hydrolyzed during the catalytic cycle

  • Divalent metal ions: Typically Mg²⁺ or Mn²⁺ at 1-5 mM concentrations

  • Reducing agents: Required to maintain the appropriate redox state, typically:

    • Dithiothreitol (DTT) at 1-5 mM

    • β-mercaptoethanol at 5-10 mM

The reaction mechanism likely involves ATP-dependent activation of the substrate, followed by cobalt insertion. The exact stoichiometry of ATP consumption per catalytic cycle should be determined experimentally, but typically ranges from 1-3 ATP molecules per substrate molecule processed.

For optimal in vitro activity assays, buffer compositions similar to those used for other archaeal enzymes would be appropriate:

  • 50 mM Tris-HCl (pH 8.0-9.0)

  • 10% glycerol for stabilization

  • 50-100 mM NaCl

  • The aforementioned cofactors at their optimal concentrations

What kinetic parameters characterize recombinant Pyrococcus horikoshii Cobalamin synthase and how do they compare to other Cobalamin synthases?

The kinetic parameters of recombinant P. horikoshii Cobalamin synthase would typically be characterized by:

ParameterLikely RangeComparative Notes
Optimal pH7.5-9.0Higher than mesophilic homologs
Optimal temperature70-90°CReflects hyperthermophilic origin
Km for hydrogenobyrinic acid a,c-diamide1-50 μMSubstrate concentration for half-maximal activity
kcat1-30 s⁻¹Likely comparable to other thermostable enzymes
Catalytic efficiency (kcat/Km)10⁵-10⁶ M⁻¹s⁻¹May be lower at mesophilic temperatures
Km for ATP0.1-1.0 mMSimilar to other ATP-utilizing enzymes

Comparative analysis with mesophilic Cobalamin synthases would likely reveal:

  • Higher temperature optimum for P. horikoshii enzyme

  • Greater thermostability but possibly lower activity at ambient temperatures

  • Similar substrate specificity profile with possible variations in affinity

Like other enzymes from extremophiles, P. horikoshii Cobalamin synthase likely exhibits trade-offs between stability and catalytic efficiency, particularly at non-optimal temperatures. The enzyme may show lower activity at mesophilic temperatures but maintain functionality under conditions where mesophilic homologs would be completely denatured .

What analytical methods are most effective for characterizing the products of Pyrococcus horikoshii Cobalamin synthase reactions?

Characterizing the products of P. horikoshii Cobalamin synthase reactions requires sophisticated analytical techniques given the complex structure of cobalamin and its precursors:

  • Chromatographic methods:

    • HPLC with reverse-phase C18 columns

    • Size-exclusion chromatography for product purity

    • Ion-exchange chromatography for charged intermediates

  • Spectroscopic techniques:

    • UV-visible spectroscopy (cobalamin compounds have characteristic absorption spectra)

    • Fluorescence spectroscopy (for detecting specific structural features)

    • Circular dichroism for structural characterization

  • Mass spectrometry:

    • ESI-MS for molecular weight determination

    • LC-MS/MS for structural elucidation of products and intermediates

    • MALDI-TOF for higher molecular weight compounds

  • Specific activity assays:

    • Colorimetric detection methods similar to the modified Wada and Snell method used for PLP synthase, where products form colored complexes with specific reagents

    • Coupling reactions where the product serves as a substrate for another enzyme with easily measurable activity

  • Nuclear magnetic resonance (NMR):

    • ¹H-NMR and ¹³C-NMR for structural confirmation

    • Heteronuclear NMR for specific atom tracking

For quantitative analysis, standard curves should be established using authentic standards of cobalamin and related compounds. When analyzing reaction kinetics, time-course experiments with sampling at regular intervals provide insights into the reaction mechanism and potential intermediate accumulation .

How can site-directed mutagenesis be used to investigate the catalytic mechanism of Pyrococcus horikoshii Cobalamin synthase?

Site-directed mutagenesis offers powerful insights into the catalytic mechanism and structure-function relationships of P. horikoshii Cobalamin synthase. A methodological framework includes:

  • Target selection strategy:

    • Conserved residues identified through multiple sequence alignment with homologous enzymes

    • Residues predicted to be in the active site based on structural modeling

    • Amino acids involved in substrate binding or catalysis in related enzymes

    • Residues unique to thermophilic versions that might contribute to thermostability

  • Methodological approach:

    • PCR-based mutagenesis using primers containing the desired mutations

    • Verification of mutations by DNA sequencing

    • Expression and purification using the same protocol as for wild-type enzyme

    • Comparative biochemical characterization

  • Key parameters to analyze for each mutant:

    • Catalytic efficiency (kcat/Km)

    • Substrate binding affinity (Kd)

    • Temperature optimum and thermostability

    • pH dependence

    • Cofactor requirements

  • Potential mutation targets based on related enzymes:

    • Histidine residues potentially involved in metal coordination

    • Arginine or lysine residues that might interact with ATP

    • Conserved aspartate or glutamate residues often critical in catalysis

    • Residues that might interact with the corrin ring structure

Analysis of the mutants should include thorough kinetic characterization and stability assessments. Comparing the properties of multiple mutants can provide a comprehensive understanding of the roles of specific residues in catalysis and substrate recognition .

What expression optimization strategies improve yields of recombinant Pyrococcus horikoshii Cobalamin synthase?

Optimizing the expression of recombinant P. horikoshii Cobalamin synthase requires systematic evaluation of multiple parameters:

  • Expression vector optimization:

    • Strong promoters (T7) with tight regulation

    • Codon optimization for E. coli usage

    • Inclusion of solubility-enhancing fusion partners (SUMO, MBP, thioredoxin)

    • Addition of purification tags that can be cleaved post-purification

  • Host strain selection:

    • E. coli BL21(DE3) for standard expression

    • E. coli BL21(DE3)pLysS for tighter control of toxic protein expression

    • Rosetta or CodonPlus strains if codon bias is an issue

    • SHuffle strains for proteins requiring disulfide bonds

  • Culture conditions optimization:

    • Medium composition (LB, TB, auto-induction media)

    • Growth temperature before induction (typically 37°C)

    • Induction temperature (often reduced to 25-30°C)

    • IPTG concentration (testing range: 0.1-1.0 mM)

    • Induction duration (4-16 hours)

  • Experimental design for optimization:

    • Test multiple conditions systematically

    • Analyze both total and soluble protein fractions

    • Use small-scale cultures (10-50 mL) for initial screening

    • Scale up only after conditions are optimized

Based on research with other thermostable proteins, a recommended starting protocol would include:

  • E. coli BL21(DE3) transformed with pET28a containing the cobS gene

  • Growth in LB medium with appropriate antibiotic to OD600 of 0.5-0.7

  • Temperature reduction to 30°C before induction

  • Induction with 0.4 mM IPTG

  • Post-induction growth for 6-16 hours

What strategies can address poor solubility of recombinant Pyrococcus horikoshii Cobalamin synthase?

Poor solubility is a common challenge when expressing recombinant proteins, including P. horikoshii Cobalamin synthase. Several methodological approaches can address this issue:

  • Expression condition modifications:

    • Lower induction temperature (16-25°C) to slow protein synthesis

    • Reduce IPTG concentration (0.1-0.2 mM) to decrease expression rate

    • Harvest cells earlier to prevent inclusion body formation

    • Add glycylglycine or ethanol to the culture medium to induce stress responses that may improve folding

  • Buffer optimization during purification:

    • Include stabilizing agents such as glycerol (10-20%)

    • Test different salt concentrations (100-500 mM NaCl)

    • Add mild detergents (0.05-0.1% Triton X-100)

    • Include specific ligands or substrates that might stabilize the protein structure

  • Protein engineering approaches:

    • Use solubility-enhancing fusion partners (MBP, SUMO, thioredoxin)

    • Express truncated versions of the protein to identify soluble domains

    • Introduce surface mutations to improve solubility without affecting the active site

  • Refolding strategies if inclusion bodies form:

    • Solubilize inclusion bodies with 6-8 M urea or guanidine hydrochloride

    • Remove denaturant gradually through dialysis or dilution

    • Add redox couples to facilitate correct disulfide bond formation

    • Use molecular chaperones to assist refolding

When working with thermostable enzymes like those from P. horikoshii, remember that they may have evolved to fold properly only at elevated temperatures. Incorporating a heat step (50-70°C for 10-30 minutes) after cell lysis can sometimes improve solubility by allowing the protein to achieve its correct folding state .

How can I address inconsistent activity measurements when working with recombinant Pyrococcus horikoshii Cobalamin synthase?

Inconsistent activity measurements are a common challenge when working with complex enzymes like Cobalamin synthase. Several methodological approaches can improve reproducibility:

  • Ensure enzyme stability during storage and assays:

    • Store enzyme at appropriate temperature (-80°C for long-term)

    • Include glycerol (10-20%) in storage buffer

    • Minimize freeze-thaw cycles

    • Pre-warm buffers and reaction components to assay temperature

  • Standardize assay conditions:

    • Maintain precise temperature control during reactions

    • Use consistent buffer composition and pH

    • Ensure anaerobic conditions if oxygen sensitivity is an issue

    • Standardize enzyme concentration determination methods

  • Address potential cofactor variability:

    • Prepare fresh ATP solutions for each assay

    • Use consistent sources and concentrations of metal ions

    • Ensure reducing agents are freshly prepared

    • Consider adding stabilizers for labile components

  • Implement robust analytical methods:

    • Use internal standards in chromatographic analyses

    • Run standard curves with each assay set

    • Perform technical replicates (minimum triplicate measurements)

    • Calculate and report standard deviations and coefficient of variation

  • Systematic control experiments:

    • No-enzyme controls to detect non-enzymatic reactions

    • Heat-inactivated enzyme controls

    • Substrate-limiting and enzyme-limiting conditions to ensure linearity

For thermostable enzymes like P. horikoshii Cobalamin synthase, temperature fluctuations during the assay can significantly impact activity measurements. Using a heat block or water bath with precise temperature control rather than relying on air incubators is strongly recommended .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.