Recombinant Pyrococcus horikoshii Probable ABC transporter permease protein PH1036 (PH1036)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

PH1036 is a 276-amino-acid transmembrane protein (UniProt ID: O58760) expressed in Escherichia coli with an N-terminal 10xHis tag for purification . Key features include:

PropertyDetails
OrganismPyrococcus horikoshii OT3 (hyperthermophilic archaeon)
Expression SystemIn vitro E. coli
Storage-20°C (short-term); -80°C for extended storage
Sequence Region1–276 (full-length)
Predicted FunctionSubstrate translocation in ABC transporter systems

Functional Role in ABC Transporters

ABC transporters like PH1036 utilize ATP hydrolysis to drive substrate translocation. PH1036 operates within a tripartite system (PH1036/PH1038/PH1039) for maltose or related carbohydrate transport . Key mechanisms include:

  • Alternating-Access Model: PH1036 shifts between inward- and outward-facing conformations to move substrates across the membrane .

  • ATP-Switch Mechanism: ATP binding induces NBD dimerization, while hydrolysis resets the transporter .

Expression and Purification

Recombinant PH1036 is produced in E. coli with the following protocol:

  1. Cloning: PH1036 gene inserted into a plasmid under a T7 promoter.

  2. Induction: IPTG-driven expression in E. coli BL21(DE3).

  3. Purification: Affinity chromatography via His-tag, followed by size-exclusion chromatography .
    Critical Notes:

  • Avoid repeated freeze-thaw cycles; store aliquots at 4°C for short-term use .

  • Shelf life: 6 months (liquid) or 12 months (lyophilized) .

Homologs and Evolutionary Conservation

PH1036 shares structural and functional similarities with bacterial ABC permeases (Table 1) :

OrganismProteinIdentityFunction
Bacillus subtilisYesQ (O31520)47.25%Dipeptide transport
Thermococcus litoralisMalG (Q7LYX6)31.99%Maltose transport
Escherichia coliUgpE (P10906)28.31%sn-glycerol-3-phosphate transport

Interaction Network

PH1036 forms functional partnerships within P. horikoshii:

  • PH1035: Synthesizes trehalose, potentially linked to PH1036’s substrate specificity .

  • PH1038/PH1039: Putative ATP-binding and substrate-binding components of the same transporter .

Applications and Research Relevance

  1. Structural Biology: PH1036’s thermostability facilitates crystallization for mechanistic studies of ABC transporters .

  2. Biotechnology: Insights into extremophile adaptation inform industrial enzyme design for high-temperature processes .

  3. Drug Resistance Studies: Homology to human ABCB1 (MDR1) aids in understanding multidrug resistance mechanisms .

Future Directions

  • Substrate Specificity: Direct transport assays are needed to confirm ligands (e.g., maltodextrins, trehalose) .

  • Cryo-EM Studies: High-resolution structures could elucidate conformational dynamics during ATP hydrolysis .

  • Engineering: Stabilizing mutations could enhance utility in synthetic biology applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PH1036; PHAJ016; Probable ABC transporter permease protein PH1036
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Target Names
PH1036
Target Protein Sequence
MKIRRYLVPNLIAWSIGIAWLIPFMGVLMASVRPYEEIVSGWWHLHPFTITLKNYINALN HPMFPIGEGLKNSLIVAIPSTIVPVIVASLAAYAFARYSFPIKHYLFAFIVLLMALPQQM TVVPLYFLLRNAHLLNTFRGLIIVHSAWGLAWIIFFMRNYFSMLPTDVEEAAKIDGATDF QIFYKIVLPMALPGLISASILQFTWVWSDFFLALVFLQNPEKYVATQRLPLLRGQYFVDW GLLTAASIMVMLVPLLVYALFQKYYISGMIGWSVEK
Uniprot No.

Target Background

Function
This protein is likely part of the PH1036/38/39 binding-protein-dependent transport system. It is probably involved in substrate translocation across the membrane.
Database Links

KEGG: pho:PH1036

STRING: 70601.PH1036

Protein Families
Binding-protein-dependent transport system permease family, MalFG subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Pyrococcus horikoshii and why are its proteins significant for research?

Pyrococcus horikoshii is a hyperthermophilic archaeon that grows optimally at extremely high temperatures (around 98°C). Proteins from this organism, including PH1036, possess exceptional thermostability, making them valuable models for studying protein structure-function relationships under extreme conditions. As demonstrated with other P. horikoshii proteins like L-threonine dehydrogenase, these proteins maintain structural integrity and activity at temperatures that would denature most proteins from mesophilic organisms . The hyperthermostable nature of these proteins provides unique opportunities to investigate fundamental mechanisms of protein folding, stability, and adaptation to extreme environments.

What is the basic function of ABC transporter permease proteins like PH1036?

ABC transporter permease proteins form the transmembrane component of ATP-Binding Cassette (ABC) transport systems. These integral membrane proteins create channels through which specific substrates pass across the cell membrane. In the complete ABC transporter complex, the permease domain associates with ATP-binding domains that provide energy through ATP hydrolysis to drive the transport process. In hyperthermophiles like P. horikoshii, these proteins likely possess specialized structural adaptations that maintain proper folding and function at extremely high temperatures while preserving the essential transport mechanisms found in all domains of life.

What expression systems are optimal for recombinant production of PH1036?

Based on successful approaches with other P. horikoshii proteins, Escherichia coli expression systems have proven effective for recombinant production of archaeal proteins . For membrane proteins like PH1036, specialized considerations include:

  • Choice of E. coli strain: C41(DE3) or C43(DE3) strains are engineered specifically for membrane protein expression

  • Expression vector design: pET-based vectors with T7 promoters and C-terminal His-tags facilitate controlled expression and subsequent purification

  • Expression conditions: Growth at 30°C until induction followed by temperature reduction to 18°C post-induction minimizes inclusion body formation

  • Induction parameters: Lower IPTG concentrations (0.1-0.3 mM) and induction at OD600 = 0.6-0.8 optimize expression while reducing toxicity

The methodological approach should include extensive optimization of these parameters to achieve functional expression of this challenging membrane protein.

What purification strategy is most effective for obtaining homogeneous PH1036 protein?

A multi-step purification strategy tailored for thermostable membrane proteins yields the best results:

Purification StepMethodologyCritical Parameters
Membrane IsolationDifferential centrifugation20,000×g for cell debris removal; 100,000×g for membrane collection
SolubilizationDetergent extraction1% DDM or LDAO, 3 hours at 4°C, gentle agitation
Heat TreatmentSelective denaturation65°C for 20 minutes (exploits thermostability)
IMACAffinity chromatographyNi-NTA with gradient elution (20-500 mM imidazole)
Size ExclusionGel filtrationSuperdex 200 in buffer containing 0.05% DDM

This approach exploits the inherent thermostability of P. horikoshii proteins, using heat treatment as a purification step to remove less stable E. coli proteins, a technique successfully employed with other recombinant proteins from this organism .

What crystallization methods are recommended for structural determination of PH1036?

Based on successful crystallization of other P. horikoshii proteins, the hanging-drop vapor-diffusion method at reduced temperatures (277K) has proven effective . For membrane proteins like PH1036, consider these methodological approaches:

  • Conventional methods: Hanging-drop vapor diffusion with 15-25% PEG 400, 100 mM MES pH 6.5, and divalent cations

  • Lipidic environments: Lipidic cubic phase (LCP) or bicelle crystallization may better mimic the native membrane environment

  • Additives: Substrate molecules or ATP analogs to capture different conformational states

  • Monoclonal antibody fragments: To increase polar surface area and facilitate crystal contacts

The crystallization of L-threonine dehydrogenase from P. horikoshii achieved diffraction to 2.20 Å resolution using the hanging-drop method, suggesting this approach may be applicable to other proteins from this organism .

How can researchers determine the oligomeric state and quaternary structure of PH1036?

Multiple complementary techniques should be employed to establish the oligomeric state with confidence:

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to determine absolute molecular weight in detergent micelles

  • Analytical ultracentrifugation (AUC) to assess homogeneity and determine sedimentation coefficients

  • Chemical crosslinking followed by SDS-PAGE to capture transient interactions

  • Native mass spectrometry to determine precise stoichiometry

  • Cryo-electron microscopy for direct visualization of quaternary structure

Based on structural studies of other P. horikoshii proteins, expect potential challenges in distinguishing protein oligomers from detergent micelles, requiring careful control experiments and detergent screening .

What methodologies can assess transport activity of recombinant PH1036?

Several complementary approaches can evaluate the functionality of purified PH1036:

  • Reconstitution into proteoliposomes: Incorporate purified protein into liposomes containing archaeal-like lipids

  • Transport assays: Monitor movement of radiolabeled or fluorescent substrates across the membrane

  • ATPase activity measurements: Quantify ATP hydrolysis rates as a proxy for transport activity

  • Thermal stability assessments: Measure protein stability using differential scanning calorimetry across a wide temperature range (20-100°C)

  • Substrate binding assays: Use isothermal titration calorimetry or microscale thermophoresis to quantify substrate interactions

These methods should be performed at various temperatures to determine the thermal optimum and compare activity profiles with mesophilic counterparts.

How does temperature affect the substrate specificity and transport kinetics of PH1036?

The relationship between temperature and function for thermophilic transporters involves several considerations:

Temperature RangeExpected Effect on PH1036Methodological Approach
25-50°CMinimal activity, rigid conformationStandard transport assays
50-80°CIncreasing activity with temperatureTemperature-controlled reconstituted systems
80-100°COptimal activity windowSpecialized high-temperature assay equipment
>100°CPotential activity decreasePressure vessels to prevent boiling

To properly characterize these relationships, researchers should:

  • Determine kinetic parameters (Km, Vmax) across a temperature gradient

  • Construct Arrhenius plots to identify energy barriers and transition temperatures

  • Compare substrate preference profiles at different temperatures

  • Assess the influence of membrane fluidity on transport rates at varying temperatures

How does PH1036 compare structurally to ABC transporter permeases from mesophilic organisms?

While specific structural data on PH1036 is not available in the provided search results, thermophilic membrane proteins typically display several adaptations:

  • Increased ionic interactions, particularly salt bridges on the protein surface

  • Higher proportion of charged residues (Arg, Glu) relative to uncharged polar residues (Ser, Thr)

  • More compact hydrophobic core with reduced cavity volume

  • Shortened loop regions with increased proline content

  • Strategic placement of glycine residues to maintain necessary flexibility

X-ray crystallographic analysis of other P. horikoshii proteins has revealed some of these adaptations, including distinctive space group organization and packing arrangements that may contribute to thermostability .

What can comparative genomics reveal about the evolution of PH1036?

Methodological approaches for evolutionary analysis include:

  • Multiple sequence alignment of ABC transporter permeases across archaeal, bacterial, and eukaryotic domains

  • Phylogenetic tree construction using maximum likelihood or Bayesian methods

  • Analysis of selective pressure on individual residues using dN/dS ratios

  • Identification of co-evolving residue networks using mutual information analysis

  • Mapping of conserved and variable regions to predicted functional domains

These analyses can reveal whether thermostability adaptations evolved gradually or through punctuated events, and identify specific residues that correlate with growth temperature optima across species.

How can PH1036 serve as a model system for membrane protein engineering?

The extreme stability of PH1036 makes it an excellent platform for protein engineering studies:

  • Thermostability principles: Identifying key stabilizing interactions that can be transferred to mesophilic homologs

  • Rational design: Engineering chimeric transporters with domains from thermophilic and mesophilic proteins

  • Directed evolution: Using PH1036 as a scaffold for evolving novel substrate specificities under harsh conditions

  • Structure-guided mutagenesis: Systematically testing the contribution of specific residues to thermal stability

  • Computational design: Using machine learning approaches trained on thermophilic proteins to predict stabilizing mutations

These approaches can yield transporters with enhanced stability for biotechnological applications such as biosensors, biocatalysis, and drug delivery systems.

What insights can cryo-EM provide about the conformational dynamics of PH1036?

Single-particle cryo-electron microscopy offers several advantages for studying membrane transporters like PH1036:

  • Visualizing multiple conformational states simultaneously in a single sample

  • Capturing transient intermediates in the transport cycle

  • Studying the protein in a more native-like lipid environment using nanodiscs

  • Determining structures at different temperatures to understand thermal adaptation

  • Visualizing the complete ABC transporter complex including the ATP-binding domains

Methodologically, researchers should consider:

  • Vitrification conditions optimized for membrane proteins in detergent micelles or nanodiscs

  • Collection of data at various ATP concentrations to capture different states

  • Image processing approaches that can classify heterogeneous conformational populations

  • Correlation with functional data to assign mechanistic roles to observed conformations

What are common challenges in maintaining functional integrity of PH1036 during recombinant expression?

Several challenges frequently arise when working with recombinant thermophilic membrane proteins:

  • Protein misfolding or aggregation due to the difference between E. coli cytoplasmic membrane and archaeal membrane composition

  • Toxicity to host cells when overexpressed

  • Formation of inclusion bodies

  • Improper disulfide bond formation under reducing cytoplasmic conditions

Methodological solutions include:

  • Lowering expression temperature (16-20°C)

  • Co-expression with molecular chaperones

  • Fusion with solubility-enhancing tags (MBP, SUMO)

  • Supplementation with specific archaeal lipids during expression

  • Using E. coli strains with oxidizing cytoplasm if disulfide bonds are present

How can researchers overcome challenges in functional reconstitution of PH1036?

Functional reconstitution of thermophilic membrane proteins presents unique challenges requiring methodological optimization:

ChallengeSolutionMethodological Approach
Detergent selectionScreen multiple detergentsStability assays with various detergents (DDM, LDAO, C12E8)
Lipid compositionMimic archaeal membranesInclude synthetic tetraether lipids or extremophile extracts
Protein orientationControl directionalitypH gradient during reconstitution; protease protection assays
ThermostabilityMaintain native foldingPerform reconstitution at elevated temperatures (40-60°C)
Activity verificationConfirm functionalityTransport assays across temperature ranges; ATPase activity measurement

A systematic approach to optimizing these parameters will maximize the likelihood of successful functional reconstitution for subsequent studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.