Recombinant Pyrococcus horikoshii Probable ABC transporter permease protein PH1215 (PH1215)

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Characteristics

Recombinant Pyrococcus horikoshii Probable ABC transporter permease protein PH1215 (PH1215) is a synthetic version of the native protein encoded by the PH1215 gene in the thermophilic archaeon Pyrococcus horikoshii. It belongs to the ATP-binding cassette (ABC) transporter family, which facilitates substrate translocation across membranes through ATP hydrolysis .

ParameterValue
Source OrganismPyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974)
Uniprot IDO58968
Expression HostEscherichia coli
TagN-terminal His-tag
Protein LengthFull-length (1–292 amino acids)
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
StabilityStore at -20°C/-80°C; avoid repeated freeze-thaw cycles

Research Applications

PH1215 is commercially available as a recombinant protein, enabling biochemical and functional studies:

  • Structural Analysis: Crystallization attempts (e.g., PH1566, a related KH-domain protein) highlight the feasibility of studying archaeal ABC transporters .

  • Functional Assays: Kinetic studies to determine substrate affinities or ATPase activity .

Expression and Localization

Proteomic studies indicate PH1215’s expression under diverse conditions, though specific expression levels in P. horikoshii are not fully characterized. Limited data from Pseudomonas spp. suggest ABC transporters are regulated by metabolic substrates .

ConditionExpression Level (log₂E)Source
Glucose0
Vanillate0
Lignin (intra)0
Lignin (extra)0

Note: Expression data for PH1215 in P. horikoshii are not explicitly reported; values above represent general trends for ABC transporters in other organisms .

Challenges and Future Directions

Despite its commercial availability, PH1215’s precise physiological role remains uncharacterized. Key gaps include:

  • Substrate Identification: No experimental evidence links PH1215 to specific molecules.

  • Thermostability: Unlike hyperthermostable enzymes like P. horikoshii endoglucanase (PhEG), PH1215’s thermal tolerance is unreported .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
PH1215; PHBK039; Probable ABC transporter permease protein PH1215
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Target Names
PH1215
Target Protein Sequence
MRRSPDLPYIILFLIPALILIGIFVYFAVVWNIYISFTDWRGLIPSYHFVGLAQYKQLIH DPIFWTSLRNNLLLILLFVPGSLLLGLFLAILLDMKVRFESGFRTIYVLPFALSFVVTAT LWAWMYDPSSGVLNVLFDKLGLDFLKSGWITDPKIAMYCIIIALIWQFSGYTMIIYLAGI RSIPIEQYEGALIDGASTWQLYRYIVIPQLTKPTLSAFVVLMVFSLKAFDFIWVLTRGGP GTSTFILAIEMYKETFAKTNFAYGAAIATILLLMALVVVLPYLYWSYKGEER
Uniprot No.

Target Background

Function
This protein is likely part of a binding-protein-dependent transport system PH1214/15/16. It is probably responsible for substrate translocation across the membrane.
Database Links

KEGG: pho:PH1215

STRING: 70601.PH1215

Protein Families
Binding-protein-dependent transport system permease family, MalFG subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is PH1215 and what is its structural composition?

PH1215 is a probable ABC transporter permease protein from the hyperthermophilic archaeon Pyrococcus horikoshii. It consists of 292 amino acids and functions as a membrane-spanning component (integral membrane domain) of an ABC transport system . The protein contains multiple transmembrane helices that form channels through which substrates can pass across the cell membrane. Structural analysis indicates PH1215 likely contains the typical six transmembrane α-helices configuration commonly found in ABC transporter permease components . As a membrane protein, it has a hydrophobic core that interacts with the lipid bilayer and more hydrophilic regions that face the cytoplasm and extracellular space, allowing it to facilitate substrate transport across the membrane.

What is the evolutionary classification of PH1215 within ABC transporter systems?

PH1215 belongs to the ABC (ATP-binding cassette) superfamily, which is universally distributed among living organisms. ABC systems can be phylogenetically divided into three main classes that closely match their functional divisions: exporters, importers, and those involved in cellular processes beyond transport . Based on its sequence characteristics and predicted topology, PH1215 likely belongs to class 3 ABC systems, which typically function as importers and have separate polypeptide chains for the integral membrane domains and ATP-binding cassette domains . This evolutionary classification provides important context for understanding PH1215's function and relationships to other ABC transporters across diverse species.

What are the expression conditions for obtaining functional recombinant PH1215?

For laboratory expression of functional recombinant PH1215, the protein is typically produced in E. coli expression systems with an N-terminal His-tag to facilitate purification . The expression protocol involves optimization of induction conditions (temperature, IPTG concentration, and induction time) to balance protein yield with proper folding. Since PH1215 is a membrane protein, specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) may improve yields. For functional studies, the protein must be solubilized using appropriate detergents that maintain the native conformation. Typical purification involves immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography to obtain homogeneous protein preparations suitable for functional and structural studies.

How does the thermostability of PH1215 compare to mesophilic ABC transporters?

As a protein from the hyperthermophilic archaeon P. horikoshii, PH1215 likely exhibits remarkable thermostability compared to its mesophilic counterparts. Similar proteins from P. horikoshii, such as the characterized pyrophosphatase, demonstrate extreme heat stability with activity at temperatures up to 70°C and a half-life of approximately 50 minutes even at 105°C . This thermostability makes PH1215 particularly valuable for structural studies and biotechnological applications requiring robust proteins. The enhanced stability likely results from several structural features common to thermophilic proteins, including increased hydrophobic interactions, additional salt bridges, more compact packing, and reduced surface loop regions. Researchers investigating PH1215 can leverage this thermostability for extended incubation periods during functional assays and for maintaining activity under harsh experimental conditions.

What methodologies are recommended for studying substrate specificity of PH1215?

Determining the substrate specificity of PH1215 requires a multi-faceted approach:

  • Reconstitution Studies: Purified PH1215 should be reconstituted with its cognate ATP-binding protein in proteoliposomes to create a functional transport system. This allows for direct transport assays using radioactively or fluorescently labeled potential substrates.

  • Binding Assays: If PH1215 works with a substrate-binding protein (common in ABC importers), isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) can be used to screen candidate substrates.

  • Comparative Genomics: Analysis of gene neighborhoods in P. horikoshii and related species can provide insights into potential substrates based on metabolic context.

  • Mutagenesis: Systematic mutation of residues lining the predicted substrate pathway can help identify critical binding sites.

  • Structural Studies: Cryogenic electron microscopy (cryo-EM) or X-ray crystallography of PH1215 with bound substrates can definitively identify substrate binding sites.

These approaches should be used in combination, as single methods may provide incomplete information about the complex substrate recognition and transport mechanism of ABC transporters.

How can researchers investigate the interaction between PH1215 and its cognate ATP-binding domain?

Investigation of the interaction between PH1215 (permease domain) and its cognate ATP-binding domain requires several complementary approaches:

  • Co-purification Experiments: Express both proteins with different tags and assess whether they co-purify, indicating a stable interaction.

  • Pull-down Assays: Use immobilized PH1215 to capture the ATP-binding domain from a complex mixture, confirming specific interactions.

  • Surface Plasmon Resonance: Quantitatively measure binding kinetics and affinity between the purified components.

  • Cross-linking Studies: Chemical cross-linking followed by mass spectrometry can identify specific residues involved in the interaction interface.

  • Microscale Thermophoresis: Detect interactions based on changes in the thermophoretic mobility of fluorescently labeled proteins.

The research should focus on the transmission interface between the permease and ATP-binding domains, which typically involves intracellular loops (ICLs) of the permease making contact with conserved motifs like the Q-loop in the ATP-binding domain . Additionally, mutations in these interface regions can validate the importance of specific residues for functional coupling between the domains.

What are the challenges in crystallizing PH1215 for structural studies, and how can they be addressed?

Membrane proteins like PH1215 present several challenges for crystallization and structural determination:

ChallengePotential Solutions
Protein instability in detergentsScreen multiple detergents; use lipid-like surfactants (e.g., MSPs, nanodiscs)
Conformational heterogeneityLock protein in specific conformations using inhibitors or non-hydrolyzable ATP analogs
Low expression yieldsOptimize expression systems; consider cell-free expression
Crystal packing difficultiesUse antibody fragments or designed ankyrin repeat proteins (DARPins) as crystallization chaperones
Phase determination issuesExpress selenomethionine-incorporated protein for SAD/MAD phasing

For PH1215 specifically, its thermostability can be advantageous for crystallization. Incubation at moderately high temperatures (50-60°C) prior to crystallization trials may increase conformational homogeneity by allowing the protein to adopt its most stable conformation. Additionally, co-crystallization with its cognate ATP-binding domain may stabilize the complex and provide better diffraction quality crystals. If crystallization proves challenging, researchers should consider alternative structural determination methods such as cryo-electron microscopy, which has revolutionized membrane protein structural biology in recent years.

How might researchers engineer PH1215 for enhanced activity or altered substrate specificity?

Engineering PH1215 for enhanced activity or altered substrate specificity requires a systematic approach:

  • Structure-guided Mutagenesis: Once structural information is available, residues lining the substrate-binding pocket can be mutated to alter specificity. Conservative mutations (maintaining similar chemical properties) may enhance activity while more dramatic changes might alter specificity.

  • Directed Evolution: Create libraries of PH1215 variants through error-prone PCR or DNA shuffling, followed by selection or screening for desired properties. For membrane proteins, this often requires specialized selection systems like genetic complementation in transport-deficient strains.

  • Domain Swapping: Exchange regions of PH1215 with homologous regions from related transporters with different specificities to create chimeric proteins with novel properties.

  • Computational Design: Use molecular dynamics simulations and computational protein design to predict mutations that might enhance stability or alter substrate binding.

  • Ancestral Sequence Reconstruction: Resurrect ancestral sequences of PH1215 that might have broader specificity, then refine through further engineering.

When implementing these strategies, researchers should consider the phylogenetic context of ABC transporters and focus engineering efforts on regions known to determine substrate specificity, such as the transmembrane helices that form the translocation pathway .

What analytical techniques are most effective for studying conformational changes in PH1215 during the transport cycle?

Understanding the conformational dynamics of PH1215 during the transport cycle requires sophisticated biophysical techniques:

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique can identify regions of the protein that undergo conformational changes by measuring the rate at which backbone amide hydrogens exchange with deuterium from the solvent. Changes in exchange rates in the presence of ATP, ADP, or substrates can reveal dynamic aspects of the transport mechanism.

  • Single-molecule Förster Resonance Energy Transfer (smFRET): By labeling specific residues with fluorescent dyes, researchers can monitor distance changes between protein domains during the transport cycle in real-time, providing insights into the conformational states.

  • Electron Paramagnetic Resonance (EPR) Spectroscopy: Site-directed spin labeling combined with EPR can measure distances between labeled sites and detect conformational changes with high sensitivity.

  • Molecular Dynamics Simulations: Computational approaches can model the conformational changes at atomic resolution, particularly valuable when integrated with experimental data.

  • Time-resolved Cryo-EM: This emerging technique can potentially capture different conformational states of the transport cycle by rapid freezing at different time points after initiation of transport.

These techniques should be applied in the context of understanding the alternating access mechanism typical of ABC transporters, where the substrate-binding site alternates between being accessible from one side of the membrane to the other during the transport cycle .

What are the optimal conditions for functional reconstitution of PH1215 in liposomes?

Functional reconstitution of PH1215 in liposomes requires careful optimization of several parameters:

ParameterRecommended Conditions
Lipid CompositionMixture of E. coli polar lipids and POPC (7:3 ratio)
Protein:Lipid RatioInitial screening of 1:50 to 1:200 (w/w)
Detergentn-Dodecyl-β-D-maltoside (DDM) or Lauryl Maltose Neopentyl Glycol (LMNG)
Detergent RemovalBio-Beads SM-2 or dialysis against detergent-free buffer
Buffer Composition20 mM HEPES, 100 mM KCl, pH 7.4
TemperatureRoom temperature for reconstitution, functional assays at 50-70°C

For optimal activity, PH1215 should be reconstituted together with its cognate ATP-binding protein. The presence of Mg²⁺ (1-5 mM) is critical for ATP hydrolysis during functional assays. Due to the thermophilic nature of P. horikoshii, using more rigid lipids with higher transition temperatures may improve functional reconstitution. After reconstitution, the proteoliposomes should be characterized for protein incorporation (freeze-fracture electron microscopy), size homogeneity (dynamic light scattering), and functional activity (ATP hydrolysis assays and substrate transport measurements).

How should researchers address solubility and stability issues when working with recombinant PH1215?

Working with membrane proteins like PH1215 presents unique solubility and stability challenges that can be addressed through several strategies:

  • Optimized Detergent Selection: Screen a panel of detergents including DDM, LMNG, GDN, and CYMAL-5 to identify those that maintain PH1215 in a stable, monodisperse state. The stability can be assessed using size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS).

  • Thermal Stability Assays: Given PH1215's thermophilic origin, perform thermal denaturation assays (such as differential scanning fluorimetry) in various buffers and detergents to identify conditions that maximize thermal stability.

  • Lipid Supplementation: Addition of specific lipids (e.g., cardiolipin or archaeal lipids) to detergent micelles can significantly enhance stability by mimicking the native membrane environment.

  • Protein Engineering: Introduction of disulfide bonds or removal of flexible loops can improve protein stability without affecting function.

  • Alternative Solubilization Systems: Consider nanodiscs, amphipols, or styrene-maleic acid lipid particles (SMALPs) as alternatives to traditional detergents for maintaining PH1215 in a native-like environment.

Researchers should also consider the unique archaeal origin of PH1215 when designing purification strategies. The protein may require higher salt concentrations (0.5-1 M) and slightly acidic pH values (pH 5.5-6.5) to maintain stability, reflecting the intracellular conditions of P. horikoshii .

What control experiments are essential when characterizing the ATPase activity coupled to the transport function of PH1215?

When characterizing the ATPase activity coupled to transport function, several critical control experiments must be included:

  • Basal ATPase Activity: Measure ATP hydrolysis in the absence of substrate to establish baseline activity.

  • Substrate Stimulation: Determine how putative substrates affect the rate of ATP hydrolysis; a genuine substrate should stimulate ATPase activity.

  • Uncoupled Mutants: Generate mutants in the transmission interface between PH1215 and its ATP-binding partner that maintain ATPase activity but lack transport function to demonstrate coupling.

  • Vanadate Inhibition: Orthovanadate inhibits ABC transporters by trapping them in a transition state; sensitivity to vanadate confirms ATP hydrolysis is linked to the ABC transport mechanism.

  • Non-hydrolyzable ATP Analogs: ATP-γ-S or AMP-PNP should not support transport, confirming that ATP hydrolysis (not just binding) is required.

  • Cation Requirements: Substitute Mg²⁺ with other divalent cations (Ca²⁺, Mn²⁺, Co²⁺) to determine specificity, as different ABC transporters show varying preferences .

  • Temperature Dependence: For a thermophilic protein like PH1215, establish the temperature profile of ATPase activity, which should align with the growth temperature of P. horikoshii.

These controls help distinguish between direct effects on transport function versus secondary effects on ATP hydrolysis, providing a more complete understanding of the coupling mechanism in this archaeal ABC transporter.

How does PH1215 compare functionally with other archaeal ABC transporters?

Comparative analysis of PH1215 with other archaeal ABC transporters reveals important evolutionary and functional relationships:

  • Sequence Conservation: Archaeal ABC transporters often show moderate sequence identity among permease domains (typically 20-40%), with higher conservation in the ATP-binding domains . PH1215 likely follows this pattern, with specific sequence motifs that identify it as part of a particular substrate-specific subfamily.

  • Thermophilic Adaptations: Compared to ABC transporters from mesophilic archaea, PH1215 likely contains additional structural features that enhance thermostability, similar to those observed in other P. horikoshii proteins . These may include increased hydrophobic core packing, additional salt bridges, and reduced surface loop regions.

  • Substrate Specificity: Archaeal ABC transporters have evolved to transport substrates relevant to their ecological niches. For hyperthermophiles like P. horikoshii, which often inhabit nutrient-limited environments such as deep-sea hydrothermal vents, transporters may be specialized for scavenging essential nutrients or metals.

  • Regulatory Mechanisms: The regulation of archaeal ABC transporters often differs from their bacterial counterparts, reflecting the unique transcriptional and translational control mechanisms in archaea. Understanding these differences is essential for interpreting functional studies of PH1215 in its native context.

Future comparative genomics and functional studies will be needed to fully elucidate where PH1215 fits within the diverse landscape of archaeal ABC transporters and how its specific adaptations reflect the environmental pressures faced by P. horikoshii.

What emerging technologies might advance our understanding of PH1215 structure and function?

Several cutting-edge technologies show promise for advancing our understanding of PH1215:

  • Cryo-Electron Tomography: This technique can potentially visualize ABC transporters in their native membrane environment, providing insights into the natural organization and interactions of PH1215.

  • Microfluidic-based Single Vesicle Assays: These allow real-time monitoring of transport events at the single-molecule level, providing unprecedented insights into transport kinetics and mechanisms.

  • AlphaFold and Other AI-based Structure Prediction: These computational approaches can predict structures of protein complexes, potentially revealing how PH1215 interacts with its ATP-binding domain and substrate-binding proteins.

  • Native Mass Spectrometry: This technique can analyze intact membrane protein complexes, determining subunit stoichiometry and identifying associated lipids that might be important for function.

  • CRISPR-based Genome Editing of P. horikoshii: As genetic tools for hyperthermophilic archaea improve, in vivo studies of PH1215 in its native organism will become possible, allowing correlation of biochemical findings with physiological roles.

  • Time-resolved Serial Femtosecond Crystallography: Using X-ray free-electron lasers, this technique might capture transient conformational states during the transport cycle at atomic resolution.

These technologies, especially when used in combination, promise to overcome current limitations in studying membrane proteins from hyperthermophilic organisms and provide a more comprehensive understanding of PH1215's structure, function, and physiological role.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.