Recombinant Pyrococcus horikoshii Probable ABC transporter permease protein PH1216 (PH1216)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference when placing the order. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We determine the tag type during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
PH1216; PHBK038; Probable ABC transporter permease protein PH1216
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-275
Protein Length
full length protein
Species
Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Target Names
PH1216
Target Protein Sequence
MRRISPTRFLLYIVLIFLAAWYLLPIWSAITTSTKTGEQVALTTPVQFVFPPTFDPYREA FRELKRPILNSLIFTTFATIFSTILGSIAGFTIAKLVRGRVSRQLLALISFGIFLPYQSI LIPLVKIISSLGLYNRILGLILTHTAYGIPITTLLFTNYYYEIPDELVEAAKIDGADPWK IYTKVILPLSKAPFVVTGIYQFTNIWNDYLFGVVLTRGEEAMPATVKLANLKGSFVANWN IQMAGALIVALPTLLIMIALGKYLIRGYTSGALKG
Uniprot No.

Target Background

Function
This protein is likely part of a binding-protein-dependent transport system PH1214/15/16. It is probably responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: pho:PH1216

STRING: 70601.PH1216

Protein Families
Binding-protein-dependent transport system permease family, MalFG subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is PH1216 and what organism does it originate from?

PH1216 is a probable ABC transporter permease protein from Pyrococcus horikoshii, a hyperthermophilic archaeon isolated from hydrothermal fluid samples in the Okinawa Trough vents in the NE Pacific Ocean at a depth of 1395m. This archaeon grows optimally at 98°C (with a maximum growth temperature of 102°C) and can survive prolonged exposure to 105°C. Its optimal growth occurs at pH 7 (range 5-8) and NaCl concentration of 2.4% (range 1%-5%) .

How does PH1216 fit into the larger context of ABC transporters?

ABC transporters form one of the largest families of membrane proteins responsible for the translocation of various compounds across membranes in both prokaryotes and eukaryotes. They play critical roles in nutrient uptake, toxin export, and maintaining cellular homeostasis . In the genomic context of Pyrococcus horikoshii, PH1216 is part of an operon-like structure containing genes encoding related transport functions, similar to the arrangement seen in other archaea like Sulfolobus solfataricus . ABC transporters in extremophiles like P. horikoshii often have unique adaptations that allow them to function under harsh environmental conditions.

What are the optimal conditions for recombinant expression of PH1216?

Based on successful expression protocols, PH1216 can be effectively produced as a recombinant protein in E. coli expression systems with an N-terminal His-tag. The protein has been successfully expressed and purified to >90% purity as determined by SDS-PAGE . For hyperthermophilic proteins like PH1216, the following expression considerations are important:

  • Use of E. coli strains optimized for membrane protein expression (e.g., C41(DE3), C43(DE3))

  • Temperature reduction during induction (typically 18-25°C)

  • Extended induction times (16-24 hours)

  • Inclusion of specific chaperones to assist in proper folding

  • Use of specialized media formulations to enhance membrane protein production

What purification methods are most effective for obtaining functional PH1216?

For membrane proteins like PH1216, a purification protocol typically includes:

  • Cell lysis under conditions that preserve native protein structure

  • Membrane fraction isolation via differential centrifugation

  • Solubilization using appropriate detergents (common choices include n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin)

  • Immobilized metal affinity chromatography (IMAC) using the His-tag

  • Size exclusion chromatography for further purification

Based on comparable ABC transporter purification studies, the protein can be stored as a lyophilized powder. When reconstituting, it's recommended to use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, followed by addition of 5-50% glycerol for long-term storage .

What storage conditions maximize stability of purified PH1216?

For optimal stability of the purified protein:

  • Store at -20°C/-80°C upon receipt

  • Aliquot for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Storage buffer: Tris/PBS-based buffer containing 6% Trehalose, pH 8.0

Repeated freeze-thaw cycles should be avoided as they can significantly diminish protein activity and stability .

How should experiments be designed to investigate the substrate specificity of PH1216?

To systematically investigate substrate specificity of PH1216, consider the following experimental design approach:

  • Variable identification and control:

    • Independent variables: Substrate type, substrate concentration, pH, temperature

    • Dependent variables: Transport activity, binding affinity

    • Control variables: Buffer composition, protein concentration, lipid environment

  • Experimental treatments:

    • Test panel of potential substrates based on bioinformatic predictions

    • Vary substrate concentrations to determine kinetic parameters

    • Compare activity under different temperature and pH conditions

  • Measurement methodologies:

    • Radiolabeled substrate transport assays

    • Fluorescence-based transport assays

    • ATPase activity coupling assays

    • Isothermal titration calorimetry for binding studies

  • Data analysis approach:

    • Determine transport kinetics (Km, Vmax)

    • Compare substrate preference profiles

    • Analyze temperature and pH optima relative to native conditions

This approach follows established experimental design principles for transport proteins while accounting for the extreme conditions under which P. horikoshii proteins naturally function .

What methods can be used to study PH1216 in a native-like membrane environment?

For studying membrane proteins like PH1216 in a native-like environment, consider these methodological approaches:

  • Reconstitution into liposomes or nanodiscs:

    • Prepare liposomes with archaeal lipid extracts or synthetic archaeal-like lipids

    • For nanodiscs, use membrane scaffold proteins to create defined membrane patches

    • Incorporate purified PH1216 using detergent removal methods (dialysis, Bio-Beads)

  • Functional assays in membrane mimetics:

    • Substrate transport assays using fluorescent or radioactive tracers

    • Counterflow assays to determine transport directionality

    • Patch-clamp studies if electrogenic transport is suspected

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to confirm proper folding

    • Fluorescence resonance energy transfer (FRET) to measure conformational changes

    • Electron paramagnetic resonance (EPR) spectroscopy with spin-labeled proteins to measure distances and accessibility

  • Environmental parameter considerations:

    • Temperature range: 60-100°C (reflecting native conditions)

    • pH range: 5-8

    • Salt concentration: 1-5% NaCl

This multi-faceted approach allows for comprehensive characterization of PH1216 function in conditions that approximate its native environment.

What approaches can overcome the challenges in crystallizing membrane proteins like PH1216?

Crystallizing membrane proteins for structural studies presents significant challenges. Based on insights from successful ABC transporter crystallization studies, the following methodologies can be applied to PH1216:

  • Protein engineering approaches:

    • Truncation of flexible regions that might impede crystal formation

    • Introduction of T4 lysozyme or other domains to increase soluble surface area

    • Mutation of surface residues to enhance crystal contacts

    • Creation of fusion constructs with crystallization chaperones

  • Crystallization techniques:

    • Lipidic cubic phase (LCP) crystallization, which has been successful for many membrane proteins

    • Bicelle crystallization methods

    • Detergent screening (typically 20-50 different detergents)

    • Additive screening to identify stabilizing compounds

  • Alternative structural methods:

    • Cryo-electron microscopy (cryo-EM), especially if the protein can be purified at sufficient concentration

    • Small-angle X-ray scattering (SAXS) for low-resolution structural information

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe dynamics and accessibility

  • Optimization strategies:

    • Testing orthologues from different species, as some may crystallize more readily than others

    • Screening different expression conditions to improve protein homogeneity

    • Utilizing nanobodies or antibody fragments to stabilize specific conformations

These approaches have proven successful for structurally characterizing other challenging membrane proteins, including ABC transporters from thermophilic organisms.

How can molecular dynamics simulations provide insight into PH1216 function?

Molecular dynamics (MD) simulations can provide valuable insights into the dynamic behavior of PH1216 in a membrane environment. A comprehensive MD study of PH1216 would typically include:

  • System preparation:

    • Homology model construction based on related ABC transporters with known structures

    • Embedding in a simulated membrane with appropriate lipid composition (archaeal lipids)

    • Solvation and addition of ions to mimic cytoplasmic conditions

  • Simulation parameters:

    • High-temperature simulations (80-100°C) to mimic native conditions

    • Extended simulation times (>100 ns) to capture relevant conformational transitions

    • Multiple replicas with different starting conditions to improve sampling

  • Analysis methods:

    • Tracking conformational changes during substrate binding and transport

    • Identifying water and ion pathways through the transporter

    • Calculating free energy profiles for substrate translocation

    • Examining protein-lipid interactions specific to archaeal membranes

  • Integration with experimental data:

    • Validation of MD models with EPR distance measurements

    • Correlation with biochemical data on substrate specificity

    • Testing predictions through site-directed mutagenesis

MD simulations are particularly valuable for understanding how PH1216 maintains structural integrity and function at the extreme temperatures where P. horikoshii thrives .

How is PH1216 gene expression regulated in Pyrococcus horikoshii?

Based on genomic analysis, PH1216 appears to be part of an operon-like structure similar to other ABC transporter systems in archaea. The regulatory mechanisms likely include:

  • Transcriptional regulation:

    • Promoter elements typical of archaeal systems

    • Possible regulation by global transcription factors responding to nutrient availability

    • Potential stress-response elements in the promoter region

  • Experimental approaches to study regulation:

    • RT-qPCR analysis of gene expression under varying growth conditions

    • Chromatin immunoprecipitation (ChIP) to identify transcription factor binding sites

    • Reporter gene assays to characterize promoter activity

    • RNA-seq analysis to identify co-regulated genes

  • Environmental factors likely affecting expression:

    • Availability of specific nutrients or substrates

    • Osmotic stress conditions, as suggested by studies of related systems

    • Temperature shifts

    • Growth phase-dependent regulation

While specific regulatory data for PH1216 is limited, the gene organization suggests it may be co-regulated with other components of the ABC transporter system, similar to the mannosylglycerate synthesis operon described in P. horikoshii .

How does PH1216 compare to ABC transporters in other extremophiles?

Comparative analysis of PH1216 with ABC transporters from other extremophiles reveals important evolutionary adaptations:

OrganismABC TransporterGrowth Temp. (°C)Key AdaptationsReference
P. horikoshiiPH121698 (optimal)Membrane stability at high temperatures, likely interaction with tetraether lipids
S. solfataricusGlucose transporter80 (optimal)High-affinity substrate binding at acidic pH, glycoprotein binding component
E. coliVarious37 (optimal)Lower temperature stability, different membrane composition

The ABC transporters from hyperthermophilic archaea like P. horikoshii show several distinctive features:

  • Structural adaptations:

    • Increased number of ion pairs and hydrophobic interactions

    • More compact folding to enhance thermostability

    • Specific interactions with archaeal lipid membranes

  • Functional characteristics:

    • Retained high substrate affinity at extreme temperatures

    • Often active across broader pH ranges

    • May require higher salt concentrations for optimal activity

  • Genomic context:

    • Often organized in operons with specific adaptation-related genes

    • May contain intein elements, as noted in 11 ORFs in the P. horikoshii genome

These comparative insights provide a framework for understanding how PH1216 functions within the context of extremophile biology.

What methodological approaches can determine the ATPase activity coupling to substrate transport?

To investigate the coupling between ATP hydrolysis and substrate transport in PH1216, several complementary approaches can be employed:

  • ATPase activity assays:

    • Measure inorganic phosphate release using colorimetric methods (malachite green)

    • Real-time monitoring of ATP hydrolysis using enzyme-coupled assays

    • Compare basal vs. substrate-stimulated ATPase activity

  • Transport-ATPase coupling measurements:

    • Correlate ATP hydrolysis rates with substrate transport rates

    • Calculate coupling efficiency (molecules transported per ATP hydrolyzed)

    • Examine effects of ATP analogs (non-hydrolyzable, slowly hydrolyzable) on transport

  • Mutation studies targeting key residues:

    • Walker A and B motifs in the nucleotide-binding domain

    • Conserved residues in the transmembrane domain thought to form the translocation pathway

    • Interface residues between the nucleotide-binding domain and transmembrane domain

  • Conformational change monitoring:

    • Use site-specific labels and spectroscopic techniques to track conformational changes during the transport cycle

    • Correlate conformational states with stages of ATP binding, hydrolysis, and product release

These methodologies, based on approaches used with other ABC transporters , would provide mechanistic insights into how PH1216 couples energy from ATP hydrolysis to substrate translocation.

How can researchers identify the natural substrate(s) of PH1216?

Identifying the natural substrate(s) of orphan transporters like PH1216 requires a systematic approach:

  • Bioinformatic prediction strategies:

    • Analyze genomic context for nearby biosynthetic or metabolic genes that might provide clues to substrate identity

    • Perform phylogenetic analysis to identify close homologs with known substrates

    • Use structural homology modeling to predict substrate binding pocket characteristics

  • High-throughput screening approaches:

    • Metabolite array screening using purified protein

    • Transport assays with cellular extracts from P. horikoshii

    • Competitive binding assays with a panel of potential substrates

  • Metabolomic approaches:

    • Compare metabolite profiles of wild-type vs. knockout strains (if genetic systems available)

    • Analyze changes in metabolite concentrations under conditions where the transporter is upregulated

    • Isotope labeling to track potential substrates

  • Direct binding studies:

    • Isothermal titration calorimetry with candidate substrates

    • Surface plasmon resonance to measure binding kinetics

    • Thermal shift assays to identify stabilizing ligands

This multifaceted approach, combining computational predictions with experimental validation, offers the best chance of identifying the natural substrate(s) of PH1216.

How can insights from PH1216 be applied to engineer thermostable proteins for biotechnological applications?

The thermostable properties of PH1216 provide valuable design principles for protein engineering:

  • Thermostability determinants that can be transferred to mesophilic proteins:

    • Increased surface ion-pair networks

    • Enhanced hydrophobic core packing

    • Strategic disulfide bond placement

    • Reduction of thermolabile amino acids (Asn, Gln, Met, Cys)

    • α-helical stabilization through additional hydrogen bonds

  • Experimental approaches for thermostability transfer:

    • Domain swapping between thermophilic and mesophilic homologs

    • Consensus design based on multiple thermophilic ABC transporters

    • Directed evolution with high-temperature selection pressure

    • Computational design focusing on stability-enhancing mutations

  • Potential biotechnological applications:

    • Development of thermostable biosensors

    • Design of robust biocatalysts for industrial processes

    • Creation of stable membrane protein scaffolds for drug delivery systems

    • Engineering transport systems for bioremediation at high temperatures

Successful examples from other thermophilic proteins demonstrate that strategic incorporation of thermostabilizing features can significantly enhance the temperature stability of engineered proteins while maintaining their functional properties.

What methodological considerations are important when designing pH-responsive experiments with PH1216?

When designing pH-responsive experiments with membrane proteins like PH1216, several methodological considerations are critical:

  • Buffer selection considerations:

    • Choose buffers with appropriate pKa values for the pH range of interest

    • Ensure buffer components don't interfere with protein activity or assays

    • Consider the temperature effect on buffer pH (especially important for thermophilic proteins)

    • For extreme pH conditions, use buffers like MES (pH 5.5-6.7), PIPES (pH 6.1-7.5), and CAPS (pH 9.7-11.1)

  • Experimental design parameters:

    • Include appropriate equilibration times after pH changes

    • Monitor protein stability across the pH range tested

    • Use internal controls to account for pH effects on assay components

    • Consider pH gradients that might exist in native environments

  • Analytical methods for pH-dependent studies:

    • pH-dependent ATPase activity assays

    • pH titration of intrinsic or extrinsic fluorescence

    • Circular dichroism spectroscopy at varying pH

    • Transport assays under defined pH gradients

Based on studies with pH-responsive systems , these approaches enable rigorous characterization of pH-dependent properties while minimizing experimental artifacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.