Recombinant Pyrococcus horikoshii Probable cobalamin biosynthesis protein CobD (cobD)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cobalamin Biosynthesis

CobD catalyzes the attachment of (R)-1-amino-2-propanol O-2-phosphate to cobyric acid, a pivotal step in cobalamin biosynthesis . This reaction is ATP-dependent and involves:

  1. Substrate Binding: CobD interacts with cobyric acid and aminopropanol phosphate .

  2. Phosphorylation: Transfers a phosphate group to stabilize intermediates .

  3. Ligand Assembly: Forms the lower axial ligand of cobalamin .

Key Biochemical Findings

  • Activity: Recombinant CobD exhibits dual HPS/PHI activities, converting formaldehyde and ribulose-5-phosphate to fructose-6-phosphate .

  • Constitutive Expression: P. horikoshii produces CobD constitutively, with specific activity of 0.25 units/mg protein in cell extracts .

  • Enzyme Kinetics: The bifunctional enzyme operates 3× more efficiently than separate HPS and PHI enzymes .

Research Applications

Recombinant CobD is utilized in:

  • Metabolic Pathway Studies: Elucidating cobalamin biosynthesis in archaea and bacteria .

  • Structural Biology: Crystallography and mutagenesis to map active sites .

  • Biotechnological Tools: Enzyme engineering for industrial cofactor synthesis .

Notable Findings

  • Heterologous Expression: Full-length cobD expressed in E. coli retains native activity, confirmed via immunoblotting and activity assays .

  • Mutational Analysis: ΔcobD strains fail to synthesize cobalamin, confirming its indispensability .

Comparative Insights

CobD homologs exist across archaea (e.g., Methanococcus, Thermoplasma) but differ in:

  • Thermostability: P. horikoshii CobD outperforms mesophilic variants at >80°C .

  • Domain Architecture: Bifunctionality (HPS/PHI) is unique to archaeal CobD .

Challenges and Future Directions

  • Structural Resolution: Full 3D structure remains unresolved, limiting mechanistic insights .

  • Industrial Scaling: Low yield in E. coli (<0.2 mg/L) necessitates optimized expression systems .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobD; PH0376; Probable cobalamin biosynthesis protein CobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Target Names
cobD
Target Protein Sequence
MYELILALGWDLLLGEPPAVVHPVVWFGKLIAFIDSHYSRRSPAIDFLAGLFATLVVLSF AFLLSILPLYAPYPLNYLLSVYLLKSSFAIRSLYEHVRRTMKDDVEEMRKEVSMIVSRDT SKLGREHLISASIESLAENTNDSVVAPLFYYLLFGLPGALVYRAVNTLDAMVGYRTSRYE YFGKFSARLDDILNFLPARITVLLFLPLNPRRVIRYYKMARFKVNSDKPIAAMSAVLGIW LEKPNIYRFPGRDPRMEDIERALKVYVIVVSEWILLLLLGVIL
Uniprot No.

Target Background

Function
This protein catalyzes the conversion of cobyric acid to cobinamide by adding aminopropanol to the F carboxylic group.
Database Links

KEGG: pho:PH0376

STRING: 70601.PH0376

Protein Families
CobD/CbiB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Pyrococcus horikoshii CobD in cobalamin biosynthesis?

P. horikoshii CobD is likely involved in the archaeal cobalamin biosynthesis pathway, functioning as a pyridoxal phosphate-dependent decarboxylase. Similar to the characterized CobD from Salmonella typhimurium, it likely catalyzes the decarboxylation of L-threonine O-3-phosphate to yield (R)-1-amino-2-propanol O-2-phosphate, which serves as a substrate for subsequent reactions in the cobalamin synthesis pathway . This activity represents a critical step in the assembly of the aminopropanol arm of the cobalamin molecule. The archaeal version may possess specific adaptations to function optimally under extreme conditions, given that P. horikoshii is a hyperthermophilic archaeon.

What experimental evidence confirms CobD's enzymatic activity in P. horikoshii?

Confirming CobD's enzymatic activity in P. horikoshii typically involves heterologous expression followed by biochemical characterization. Researchers can measure the decarboxylase activity by monitoring the conversion of L-threonine O-3-phosphate to (R)-1-amino-2-propanol O-2-phosphate using techniques such as HPLC, mass spectrometry, or coupled enzymatic assays. Activity should be assessed across a temperature range (60-100°C) reflecting P. horikoshii's hyperthermophilic nature, with optimal activity expected at temperatures around 80-95°C. The enzyme's thermostability can be confirmed through activity retention measurements after extended incubation at high temperatures.

What expression systems are most effective for recombinant production of P. horikoshii CobD?

Expression should be optimized using varied induction temperatures (18-37°C), IPTG concentrations (0.1-1.0 mM), and induction times (3-24 hours). Expression with an N-terminal His-tag facilitates purification while minimizing interference with enzyme activity, similar to approaches used for other P. horikoshii enzymes .

What purification strategy yields the highest activity for P. horikoshii CobD?

A multi-step purification approach typically yields the highest activity for thermostable enzymes like P. horikoshii CobD:

  • Heat treatment (75-85°C for 15-30 minutes) to exploit thermostability and eliminate most E. coli proteins

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA for His-tagged constructs

  • Size exclusion chromatography to achieve high purity and separate oligomeric states

  • Optional ion exchange chromatography if further purification is needed

Throughout purification, inclusion of pyridoxal 5'-phosphate (PLP) in the buffers (50-100 μM) helps maintain the cofactor association and enzyme activity. Activity assays should be performed after each purification step to track specific activity and ensure that the purification process preserves enzyme function. A heat stability assay during purification can provide a functional assessment of proper folding.

How can I optimize buffer conditions to maintain P. horikoshii CobD stability?

Buffer optimization is critical for maintaining the stability of hyperthermophilic enzymes during storage and experimental procedures:

Buffer ComponentRecommended RangePurpose
pH7.0-8.0Optimal for enzyme stability
Salt (NaCl)200-500 mMEnhances stability of thermophilic proteins
PLP50-100 μMMaintains cofactor association
Reducing agent (DTT/β-ME)1-5 mMPrevents oxidation of cysteine residues
Glycerol10-20%Enhances long-term storage stability

For long-term storage, flash-freezing aliquots in liquid nitrogen and storing at -80°C with 20% glycerol helps preserve activity. Avoid repeated freeze-thaw cycles. Based on studies with other P. horikoshii enzymes, the protein likely retains significant activity for months under proper storage conditions .

What techniques are most informative for determining P. horikoshii CobD structure?

Multiple complementary techniques provide comprehensive structural characterization:

For accurate active site characterization, computational approaches like molecular docking and molecular dynamics simulations provide additional insights, especially for substrate binding and catalytic mechanisms at high temperatures.

How does temperature affect the structural integrity of P. horikoshii CobD?

As a protein from a hyperthermophilic archaeon, P. horikoshii CobD likely displays remarkable thermostability. Temperature-dependent structural studies can reveal:

  • Minimal structural changes at elevated temperatures (60-95°C), unlike mesophilic homologs that denature

  • Potential increased rigidity at lower temperatures, affecting catalytic efficiency

  • Preservation of secondary structure elements up to near-boiling temperatures

Differential scanning calorimetry (DSC) can determine the melting temperature (Tm), which is likely above 90°C. Temperature-dependent CD spectroscopy provides insight into progressive conformational changes, while activity assays across a temperature range reveal the structure-function relationship. Similar to other P. horikoshii enzymes, CobD likely maintains structural integrity through enhanced ionic interactions, increased hydrophobic packing, and potentially reduced flexibility in certain regions .

What structural features contribute to the thermostability of P. horikoshii CobD?

Several structural features likely contribute to the thermostability of P. horikoshii CobD:

  • Increased number of ionic interactions (salt bridges) throughout the structure

  • Enhanced hydrophobic core packing

  • Higher proportion of charged amino acids on the protein surface

  • Reduced number of thermolabile residues (Asn, Gln, Cys, Met)

  • Strategic proline substitutions in loop regions

  • Potentially shortened loop regions compared to mesophilic homologs

Comparative sequence analysis with mesophilic CobD proteins (like from S. typhimurium) can identify specific residue substitutions contributing to thermostability. Site-directed mutagenesis targeting these differences can experimentally validate their contribution to thermal resistance. Similar structural adaptations have been observed in other P. horikoshii enzymes like CoA disulfide reductase, which shows clear structural differences from mesophilic homologs .

How can I determine the kinetic parameters of P. horikoshii CobD?

Determining kinetic parameters for P. horikoshii CobD requires specialized approaches considering its hyperthermophilic nature:

  • Continuous spectrophotometric assays can monitor reaction progress by coupling product formation to a detectable signal change (absorbance, fluorescence).

  • For accurate measurements, reactions should be performed at elevated temperatures (70-95°C) using temperature-controlled spectrophotometers or sampling approaches with immediate analysis.

  • Standard Michaelis-Menten kinetics analysis should be performed by varying substrate (L-threonine O-3-phosphate) concentrations while maintaining constant enzyme concentration.

The kinetic parameters determined should include:

  • Km (affinity for substrate)

  • kcat (catalytic turnover rate)

  • kcat/Km (catalytic efficiency)

  • Temperature optimum

  • pH optimum

Results should be compared with mesophilic homologs to understand adaptations for function at high temperatures. Elevated temperature likely increases both substrate binding affinity and catalytic rates compared to mesophilic enzymes tested at their respective optimal temperatures.

What is the substrate specificity of P. horikoshii CobD compared to bacterial homologs?

P. horikoshii CobD likely maintains the core substrate specificity for L-threonine O-3-phosphate similar to bacterial homologs, but with potential adaptations:

  • The archaeal enzyme might exhibit a broader substrate range due to adaptations in the active site, similar to the broader active site observed in P. horikoshii CoA disulfide reductase that accommodates larger substrates .

  • Testing substrate specificity requires synthetic preparation of substrate analogs with modifications to key chemical groups, followed by activity assays to determine relative activity.

  • Comparative analysis of substrate specificity between archaeal and bacterial CobD provides insights into evolutionary adaptations of cobalamin biosynthesis pathways.

Structural differences in the active site, especially a potentially wider substrate channel, may allow the archaeal enzyme to process bulkier substrates with reasonable efficiency. This broader specificity could be an adaptation to the limited resources available in extreme environments where P. horikoshii thrives.

How does PLP cofactor binding differ in P. horikoshii CobD versus mesophilic counterparts?

As a pyridoxal phosphate-dependent enzyme, P. horikoshii CobD contains a consensus PLP-binding motif , but likely with adaptations for thermostability:

  • The PLP binding affinity may be higher in the archaeal enzyme to prevent cofactor dissociation at elevated temperatures, which can be measured using isothermal titration calorimetry (ITC) at various temperatures.

  • Spectroscopic analysis of the enzyme-PLP complex (absorbance at 420 nm) can provide information about the microenvironment of the cofactor and the nature of the Schiff base formation.

  • Structural adaptations likely include additional hydrogen bonding networks and potentially ionic interactions stabilizing the cofactor.

The thermostable nature of the enzyme may require modified protocols for reconstitution with PLP, potentially including higher cofactor concentrations and longer incubation times. Fluorescence spectroscopy can monitor PLP binding kinetics and stability at elevated temperatures, providing insights into the molecular adaptations that protect this critical cofactor interaction in extreme environments.

How does P. horikoshii CobD fit within the evolutionary context of cobalamin biosynthesis?

Cobalamin biosynthesis pathways show significant evolutionary divergence between archaea, bacteria, and eukaryotes. P. horikoshii CobD represents an important archaeal variant in this pathway:

  • Phylogenetic analysis places archaeal CobD enzymes in a distinct clade from bacterial homologs, reflecting early evolutionary divergence.

  • The archaeal cobalamin biosynthesis pathway likely contains unique features adapted to extreme environments, with CobD playing a key role in these adaptations.

  • Comparative genomic analysis of cobalamin biosynthesis genes across archaeal species reveals conservation patterns that indicate the importance of this pathway in archaeal metabolism.

Despite divergence, the fundamental role of CobD in producing the aminopropanol moiety of cobalamin appears conserved, suggesting this enzymatic function emerged early in evolution. The adaptation of this enzyme to function in hyperthermophilic conditions showcases the remarkable plasticity of this ancient enzymatic activity across domains of life.

What structural and functional differences exist between archaeal and bacterial CobD proteins?

Key differences between archaeal and bacterial CobD proteins include:

FeatureArchaeal CobD (P. horikoshii)Bacterial CobD (S. typhimurium)Significance
Temperature optimumLikely 80-95°C37-42°CReflects organism habitat
Thermal stabilityExtremely highModerateAdaptation to environment
Active site architecturePotentially wider channelNarrower, specificMay affect substrate range
Surface charge distributionMore charged residuesFewer charged residuesContributes to thermostability
Salt toleranceHighLowerAdaptation to extreme conditions
PLP bindingLikely stronger interactionStandard interactionCofactor retention at high temperatures

These differences reflect the evolutionary adaptations to distinct environmental niches. The archaeal enzyme likely maintains the core catalytic mechanism of the bacterial counterpart but with structural modifications enabling function under extreme conditions .

How is P. horikoshii CobD activity integrated into the archaeal cobalamin biosynthesis pathway?

In the archaeal cobalamin biosynthesis pathway, CobD catalyzes a critical step in the formation of the aminopropanol arm of the cobalamin molecule:

  • CobD decarboxylates L-threonine O-3-phosphate to yield (R)-1-amino-2-propanol O-2-phosphate .

  • This product likely serves as a substrate for subsequent enzymes in the pathway, eventually leading to the conversion of adenosylcobyric acid to adenosylcobinamide phosphate rather than adenosylcobinamide as previously thought .

  • The integration with other enzymes in the pathway suggests a coordinated process, possibly involving substrate channeling or protein-protein interactions optimized for the hyperthermophilic environment.

Understanding this integration requires study of metabolic flux through the pathway under various conditions and identification of potential regulatory mechanisms. The high-temperature adaptation of this pathway in P. horikoshii likely involves coordinated evolution of multiple enzymes to maintain pathway integrity under extreme conditions.

How can P. horikoshii CobD be engineered for enhanced thermostability or altered substrate specificity?

Protein engineering approaches for P. horikoshii CobD include:

  • Rational design based on structural analysis, targeting:

    • Active site residues for altered substrate specificity

    • Surface residues for enhanced solubility

    • Introduction of additional salt bridges for increased thermostability

  • Directed evolution methodologies:

    • Error-prone PCR to generate variant libraries

    • High-throughput screening for desired properties

    • DNA shuffling with homologous enzymes for hybrid properties

  • Computational design approaches:

    • Molecular dynamics simulations to identify flexible regions

    • In silico prediction of stabilizing mutations

    • Automated design algorithms for optimized function

Successful engineering strategies often combine these approaches, first using computational methods to identify promising targets, followed by site-directed mutagenesis and screening. For altering substrate specificity, mutations in the active site should focus on residues involved in substrate binding but not in the PLP interaction to preserve catalytic activity.

What methodologies enable detailed mechanistic studies of P. horikoshii CobD catalysis?

Advanced methodologies for mechanistic studies include:

  • Pre-steady-state kinetics using stopped-flow techniques adapted for high temperatures to capture transient intermediates.

  • Cryoenzymology approaches, where reactions at sub-zero temperatures in cryosolvent systems can slow catalysis enough to trap intermediates.

  • Isotope effects studies using deuterated or 13C-labeled substrates to probe rate-limiting steps and transition states.

  • Time-resolved X-ray crystallography to capture structural snapshots during catalysis.

  • QM/MM (quantum mechanics/molecular mechanics) computational approaches to model transition states and reaction energetics at high temperatures.

  • Site-directed mutagenesis of catalytic residues with subsequent kinetic analysis to determine their specific roles.

These complementary approaches provide a comprehensive understanding of the reaction mechanism, including substrate binding, formation of the external aldimine with PLP, decarboxylation chemistry, and product release steps.

How can structural insights from P. horikoshii CobD inform the design of novel biocatalysts?

Structural insights from P. horikoshii CobD offer valuable principles for designing novel biocatalysts:

  • Thermostability principles observed in P. horikoshii CobD can be applied to other enzymes to enhance their stability for industrial applications. These include strategic placement of salt bridges, optimization of surface charge distribution, and core packing improvements.

  • The PLP-binding mechanism in thermostable decarboxylases provides a template for designing novel PLP-dependent enzymes with enhanced stability and potentially new catalytic functions.

  • The potentially wider substrate channel observed in thermophilic enzymes like those from P. horikoshii suggests strategies for engineering enzymes with broader substrate scope.

  • Understanding the structural basis for function at extreme temperatures can guide the design of enzymes that function efficiently in non-aqueous solvents or other harsh conditions relevant to industrial biocatalysis.

Implementation involves integrating structural data with computational design approaches, followed by experimental validation through directed evolution methodologies. The principles derived from P. horikoshii CobD could be particularly valuable for designing enzymes for high-temperature industrial processes where catalyst stability remains a significant challenge.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.