Recombinant Pyrococcus horikoshii Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Functional Role

Proteolytic Activity

  • Substrate Specificity: Targets hydrophobic regions of membrane-associated proteins, such as PH1511, regulating their turnover .

  • Mechanism: Functions as a dimer, with conformational changes in its disordered L2 loop enabling substrate binding and catalytic activation .

Biological Context

  • Operon Association: Co-expressed with PH1511, suggesting a regulatory role in membrane protein homeostasis .

  • Thermoadaptation: Oligomerization via domain swapping enhances stability under extreme thermal conditions .

Research Findings

Key Studies

Study FocusMethodologyKey ResultsSource
Crystal StructureX-ray crystallography (2.3 Å resolution)Revealed dimeric architecture with structural homology to E. coli ClpP but distinct oligomerization interfaces.
SPFH Domain DynamicsNMR, analytical ultracentrifugationDemonstrated irreversible thermal disassembly of oligomers into monomers, suggesting domain-swapping mechanism.
Proteolytic SystemsGenomic analysisIdentified HtpX as part of conserved archaeal proteolytic networks, emphasizing its role in stress response.

Biochemical Properties

PropertyValueNotes
Optimal pH7.0–8.0Tris-based buffer ideal for activity .
Storage-20°C to -80°CStable for years in glycerol-containing buffers .
ExpressionRecombinant (E. coli)Includes a purification tag (unspecified) .

Applications

  • Research Tool: Used in in vitro studies of thermostable proteases and membrane protein regulation .

  • Biotechnological Potential: Candidate for industrial processes requiring high-temperature proteolysis, such as biofuel production .

  • Commercial Availability: Sold as a recombinant protein (50 µg/vial) for ELISA and structural studies .

Open Questions

  • Regulatory Pathways: The interaction between HtpX and PH1511 remains poorly characterized in vivo.

  • Industrial Scalability: Stability in non-laboratory conditions (e.g., variable pH, ionic strength) requires further validation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributor.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; PH1256; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Target Names
htpX
Target Protein Sequence
MGLGLWIRTGILMTLLTVVLVGIGYLLGGTGGMIIAFTLALFMNLISYWFSDSIVLNWYN ARIVSEEEAPELHYIVEKLARQAGIPKPRVAIVPTMVPNAFATGRSPRNAVVAVTEGLLQ LLNKDELEGVIAHEISHIKNRDTLIQTIAAVLAGAIMILVDFARWSLWFGAYDDERDSGS VIGLILAIILAPLAATLIQLAISRSREYLADETGARISGKPHALASALMKIEEAVRYRPL RRGNPATAHMFIINPFRGIDFAELFSTHPPTEKRIERLRKIALEMGIIF
Uniprot No.

Target Background

Database Links

KEGG: pho:PH1256

STRING: 70601.PH1256

Protein Families
Peptidase M48B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Pyrococcus horikoshii Protease HtpX homolog and what makes it significant for research?

Pyrococcus horikoshii Protease HtpX homolog (htpX) is a membrane-bound zinc metalloprotease found in the hyperthermophilic archaeon Pyrococcus horikoshii, which grows optimally at 88°C . The full-length protein consists of 289 amino acids and contains multiple transmembrane domains, as evident from its hydrophobic amino acid stretches . HtpX is analogous to Escherichia coli HtpX, which participates in proteolytic quality control of membrane proteins in conjunction with FtsH, a membrane-bound ATP-dependent protease .

The significance of this protein for research lies in its exceptional thermostability and potential applications in high-temperature enzymatic processes. As a zinc-dependent metalloprotease capable of functioning under extreme conditions, it provides valuable insights into protein adaptation mechanisms in hyperthermophilic environments. Additionally, its membrane-bound nature offers a unique model for studying proteolytic systems involved in protein quality control within archaeal cell membranes.

What structural characteristics define the HtpX protease?

The HtpX protease from P. horikoshii features several distinctive structural elements that contribute to its function and stability:

  • Membrane-spanning regions: The amino acid sequence contains multiple hydrophobic segments that form transmembrane domains, anchoring the protein in the cell membrane .

  • Zinc-binding motif: Like other metalloproteases, HtpX likely contains the characteristic HEXXH motif that coordinates the catalytically essential zinc ion . This motif is critical for the protein's proteolytic activity.

  • Thermostable architecture: The protein likely possesses structural adaptations common to hyperthermophilic proteins, including reduced thermolabile residues, additional aromatic residues, and more extensive ion-pair networks that contribute to stability at high temperatures .

  • Self-cleavage capability: Similar to E. coli HtpX, the P. horikoshii homolog may undergo self-degradation upon cell disruption or membrane solubilization, suggesting autoproteolytic activity dependent on zinc availability .

These structural features collectively enable HtpX to maintain functional integrity in the extreme environment of P. horikoshii while performing its proteolytic functions.

What are the optimal conditions for HtpX enzymatic activity?

Based on studies of both P. horikoshii proteins and related proteases, the optimal conditions for HtpX activity likely include:

  • Temperature: Given that P. horikoshii grows optimally at 88°C, the protease is expected to show maximum activity at elevated temperatures, potentially between 80-95°C . Unlike mesophilic proteases, it likely retains significant activity at temperatures above 55°C, similar to other thermophilic enzymes .

  • pH: The enzyme likely functions optimally at near-neutral pH (approximately 7.0-7.6), similar to other archaeal metalloproteases .

  • Metal cofactor requirement: As a zinc metalloprotease, HtpX activity depends critically on zinc ions. Activity would be inhibited by metal chelators like 1,10-phenanthroline and can be restored by adding zinc ions .

  • Buffer composition: A Tris-based buffer system is compatible with the protein's stability, as indicated by storage recommendations .

The enzyme's remarkable thermal stability makes it particularly valuable for high-temperature applications where conventional proteases would rapidly denature.

How should recombinant P. horikoshii HtpX be stored and handled in laboratory settings?

For optimal maintenance of recombinant P. horikoshii HtpX stability and activity:

  • Long-term storage: Keep the protein at -20°C or -80°C in Tris-based buffer containing 50% glycerol .

  • Working conditions: For routine experiments, store working aliquots at 4°C for up to one week to minimize freeze-thaw cycles .

  • Freeze-thaw considerations: Repeated freezing and thawing should be avoided to prevent protein denaturation and activity loss .

  • Metal ion management: For activity assays, ensure the presence of appropriate zinc ions, as the protein's proteolytic function is zinc-dependent .

  • Denaturation prevention: If purifying the protein, consider the potential for self-degradation during extraction. Methods involving temporary denaturation followed by refolding in the presence of zinc chelators may be necessary, as demonstrated with E. coli HtpX .

Despite its thermostable nature, standard protein handling practices should still be followed to maintain optimal enzymatic activity.

What molecular mechanisms contribute to the thermostability of P. horikoshii HtpX?

The exceptional thermostability of P. horikoshii HtpX likely results from multiple structural adaptations that collectively enhance protein stability at high temperatures:

  • Reduction in thermolabile residues: Decreased content of asparagine, glutamine, cysteine, and methionine residues that are prone to deamidation or oxidation at high temperatures .

  • Enhanced hydrophobic core: Increased presence of aromatic residues that strengthen hydrophobic interactions within the protein core, providing structural rigidity .

  • Ion-pair networks: More extensive electrostatic interactions, particularly on the protein surface, contributing to thermostability through the formation of complex ion-pair networks .

  • Optimized loop structures: Potentially shorter loops surrounding the active site, helping to stabilize the protein conformation at high temperatures while maintaining catalytic functionality .

  • Metal coordination: The zinc-binding site likely contributes to structural stability in addition to its catalytic role, potentially with adaptations that maintain metal coordination at elevated temperatures .

Understanding these thermostability mechanisms has significant implications for protein engineering, potentially allowing the development of enhanced thermostable enzymes for biotechnological applications.

What techniques are most effective for analyzing the proteolytic activity of recombinant HtpX?

Several complementary approaches can be employed to comprehensively characterize HtpX proteolytic activity:

  • Gelatin zymography: This technique allows visualization of protease activity as clear bands against a blue background on gelatin-containing gels. It has been successfully used for other metalloproteases and can identify active forms of the enzyme .

  • Fluorogenic substrate assays: Employing substrates with fluorescent leaving groups (such as L-R-amc or AAFR-amc) enables quantitative measurement of proteolytic activity through fluorescence detection . The kinetic parameters derived from these assays provide valuable insights into enzyme efficiency.

  • Protein substrate degradation: Monitoring the degradation of model proteins like casein (for soluble activity) or SecY (for membrane protein activity) can confirm the enzyme's functional properties . These assays can be analyzed by SDS-PAGE or Western blotting.

  • Metal-dependence studies: Comparing activity in the presence and absence of various metal ions and chelators can confirm the metalloprotease nature and identify optimal cofactors. The addition of 1,10-phenanthroline should inhibit activity, while zinc supplementation should restore it .

  • Temperature-dependent activity profiling: Measuring activity across a temperature gradient can identify the thermal optimum and stability range, critical parameters for a hyperthermophilic enzyme.

These techniques, potentially combined with structural analysis methods, provide a comprehensive characterization of HtpX proteolytic properties.

How can site-directed mutagenesis be applied to modify the functional properties of P. horikoshii HtpX?

Site-directed mutagenesis offers powerful approaches for investigating and modifying HtpX properties, with several strategic targets:

  • Catalytic site modifications: Alterations to the presumed HEXXH motif that coordinates the zinc ion can provide insights into the catalytic mechanism and potentially modify metal specificity or activity levels.

  • Substrate binding pocket engineering: Mutations in residues lining the substrate-binding cavity could alter substrate specificity or catalytic efficiency. Studies of the PH1704 protease demonstrated that the Y120P mutation significantly enhanced catalytic efficiency (Kcat/Km increased 7.8-fold for aminopeptidase activity and 21-fold for endopeptidase activity) .

  • Active site entrance modifications: Residues controlling substrate access to the active site (similar to Tyr120 in PH1704) could be altered to modify substrate selectivity or processing rates .

  • Thermostability engineering: Targeting surface residues involved in ion-pair networks or hydrophobic interactions could further enhance thermostability or potentially adapt the enzyme to function at lower temperatures.

  • Membrane interaction domains: Modifications to transmembrane regions could alter membrane association properties or substrate accessibility.

The effects of these mutations should be assessed through activity assays, thermal stability measurements, and where possible, structural analyses to establish structure-function relationships.

What is the role of zinc in the catalytic mechanism of HtpX proteases?

Zinc plays a central and multifaceted role in HtpX proteolytic activity:

  • Catalytic core formation: In the characteristic HEXXH motif of metalloproteases, zinc is typically coordinated by two histidine residues from the motif and a third residue elsewhere in the sequence, forming the catalytic core .

  • Water activation: The coordinated zinc ion positions and activates a water molecule for nucleophilic attack on the substrate peptide bond, with the glutamate residue in the HEXXH motif acting as a general base .

  • Activity regulation: The addition of zinc is required for proteolytic activity, while metal chelators like 1,10-phenanthroline effectively inhibit enzyme function. For E. coli HtpX, zinc supplementation enabled both self-cleavage activity and degradation of substrates like casein and SecY .

  • Structural contribution: Beyond its catalytic role, zinc coordination likely contributes to the structural integrity of the active site, particularly under the high-temperature conditions where P. horikoshii HtpX functions.

  • Self-processing facilitation: Zinc appears to play a role in the self-cleavage activity observed in HtpX, necessitating chelation during purification to prevent premature self-degradation .

This central role of zinc explains why purification protocols often include steps to manage zinc availability, removing it during purification and reintroducing it for activity assays.

What are the most effective strategies for purifying active recombinant P. horikoshii HtpX?

Purification of active HtpX presents unique challenges due to its membrane-bound nature and potential self-degradation activity. Effective strategies include:

  • Denaturing purification followed by refolding: Based on successful approaches with E. coli HtpX, purification under denaturing conditions (using urea or guanidinium hydrochloride) prevents self-degradation during extraction . This is followed by controlled refolding in the presence of zinc chelators.

  • Zinc management: Inclusion of zinc chelators during extraction and initial purification steps prevents self-degradation, while zinc can be reintroduced later to restore activity for functional studies .

  • Affinity chromatography: Expression with affinity tags facilitates purification while potentially protecting against self-degradation. Common options include His-tag, which enables immobilized metal affinity chromatography (IMAC).

  • Heat treatment: Exploiting the thermostable nature of P. horikoshii proteins, an initial heat treatment of cell lysates (e.g., 70-80°C for 15-30 minutes) can denature most host proteins while leaving the target thermostable protein soluble and active.

  • Membrane protein solubilization: Careful selection of detergents for membrane protein extraction is critical, with mild non-ionic detergents often preferred to maintain structural integrity.

The purification strategy should be validated by confirming both protein purity (via SDS-PAGE) and enzymatic activity (using appropriate activity assays) at each purification stage.

How can researchers accurately determine the kinetic parameters of P. horikoshii HtpX?

Accurate kinetic parameter determination for HtpX requires specialized approaches considering its thermostable and proteolytic nature:

  • Substrate selection and preparation: Utilize both synthetic peptide substrates with fluorogenic or chromogenic reporters and protein substrates like casein to comprehensively characterize activity . Substrate purity and concentration determination are critical for accurate measurements.

  • High-temperature reaction conditions: Perform kinetic measurements at temperatures relevant to physiological conditions (80-90°C), using specialized equipment capable of maintaining stable high temperatures during measurements.

  • Reaction monitoring approaches:

    MethodApplicationReadout
    Fluorogenic peptide assaysQuantitative kineticsFluorescence increase over time
    Chromogenic substratesContinuous monitoringAbsorbance change
    SDS-PAGE analysisProtein substrate degradationBand intensity decrease
    Circular dichroismStructural changes during catalysisSpectral shifts
  • Steady-state kinetics analysis: Measure initial reaction velocities at varying substrate concentrations to determine Km, Vmax, kcat, and kcat/Km values using appropriate enzyme kinetics models.

  • Data analysis considerations: Account for potential complicating factors including substrate inhibition, product inhibition, or non-Michaelis-Menten kinetics that may be observed with this complex enzyme.

When reporting kinetic parameters, clearly specify all experimental conditions, particularly temperature, pH, and metal ion concentrations, to enable meaningful comparisons with other studies.

What experimental controls are essential when working with recombinant P. horikoshii HtpX?

Robust experimental design for HtpX studies requires multiple controls to ensure valid and interpretable results:

  • Metal dependency controls:

    • Negative control: Include samples with EDTA or 1,10-phenanthroline to demonstrate zinc-dependence of observed proteolytic activity .

    • Restoration control: Test activity recovery by adding back zinc after chelation to confirm specific metal requirements .

  • Specificity controls:

    • Substrate panel: Test multiple substrates alongside non-substrate proteins to confirm proteolytic specificity.

    • Inactive enzyme variant: Use a catalytically inactive mutant (e.g., with altered HEXXH motif) as a negative control.

  • Condition validation controls:

    • Temperature gradient: Include temperature-dependent activity measurements to verify thermostable properties.

    • pH optimization: Test activity across a pH range to identify optimal conditions.

  • Protease classification controls:

    • Inhibitor panel: Test various classes of protease inhibitors (serine, cysteine, aspartic) as negative controls against which the metalloprotease classification can be confirmed .

    • Alternative metal ions: Test activity with different divalent metals to establish zinc specificity.

  • Self-degradation monitoring:

    • Time-course analysis: Monitor potential self-degradation during storage and experiments through SDS-PAGE or activity measurements over time .

These controls collectively ensure that observed activities are specifically attributable to the recombinant P. horikoshii HtpX rather than experimental artifacts or contaminants, while providing valuable data about the enzyme's properties and requirements.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.