Recombinant Pyrococcus horikoshii Uncharacterized protein PH2001 (PH2001)

What are the basic properties of Pyrococcus horikoshii PH2001 protein?

PH2001 is an uncharacterized protein from the hyperthermophilic archaeon Pyrococcus horikoshii (strain ATCC 700860/DSM 12428/JCM 9974/NBRC 100139/OT-3). The full-length protein consists of 147 amino acids with the sequence: MLVIVGGTTTGILFLGPRYLPRYLPILGINGASAMKKSYFLANFLACLGLLAISSSSALLITSSPSLLAASATAPSAMTAIFTSFPLPWGSTTSSLNLFSGRLRSISLRFTATSTLCVKLRGLARALASFTASTIFCLSKAILDIPP . The protein has a UniProt ID of O57781 and is categorized as a hypothetical protein, meaning its function has been predicted from an open reading frame but has not been experimentally verified .

How should researchers store and reconstitute recombinant PH2001 protein?

For optimal preservation of recombinant PH2001 protein:

Storage recommendations:

• Store the lyophilized powder at -20°C to -80°C upon receipt

• Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

• Working aliquots can be stored at 4°C for up to one week

• Use Tris/PBS-based buffer with 6% Trehalose, pH 8.0 as storage buffer

Reconstitution protocol:

• Briefly centrifuge the vial prior to opening to bring contents to the bottom

• Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (recommended default: 50%)

• Aliquot for long-term storage at -20°C/-80°C

Why are uncharacterized proteins like PH2001 important in research?

Uncharacterized proteins like PH2001 represent significant research opportunities for several reasons:

• Genomic completeness: Hypothetical proteins constitute a substantial fraction of proteomes in both prokaryotes and eukaryotes, making up a significant portion of the genetic material in sequenced organisms .

• Novel function discovery: These proteins may possess entirely new functions, enzymatic activities, or structural motifs not previously described in biology .

• Evolutionary insights: Studying conserved hypothetical proteins across species can provide insights into evolutionary relationships and protein family emergence.

• Therapeutic potential: Identification of new structures and functions can serve as markers and pharmacological targets for drug design, discovery, and screening, particularly from extremophiles like P. horikoshii that produce stable proteins .

• Industrial applications: Proteins from hyperthermophiles often possess exceptional stability and unique enzymatic properties valuable for biotechnological applications.

How should I design experiments for functional characterization of an uncharacterized protein like PH2001?

When designing experiments to characterize PH2001 or similar uncharacterized proteins, consider this methodological framework:

Step 1: Bioinformatic analysis

• Perform sequence similarity searches (BLAST, HMM profiles)

• Identify conserved domains and motifs

• Conduct phylogenetic analysis to identify orthologs

• Use structure prediction tools (AlphaFold, RoseTTAFold)

• Employ gene neighborhood analysis to identify functional associations

Step 2: Experimental validation

• Design experiments based on predicted functions

• Use multiple complementary approaches:

Step 3: Data integration

• Combine bioinformatic predictions with experimental results

• Develop testable hypotheses for further validation

• Iterate experimental design based on initial findings

What specific challenges should be considered when working with proteins from hyperthermophilic organisms?

Working with proteins from hyperthermophiles like P. horikoshii presents unique challenges that require specialized approaches:

• Temperature optimization:

  • Standard assay temperatures (25-37°C) may not reveal the protein's natural activity

  • Design assays at multiple temperatures (37°C, 60°C, 80°C, 100°C)

  • Ensure substrate stability at high temperatures

• Buffer considerations:

  • Use buffers with high thermal stability (e.g., phosphate rather than Tris)

  • Account for pH shifts with temperature changes

  • Consider higher salt concentrations that mimic native environments

• Stability vs. activity trade-offs:

  • Expression in mesophilic hosts (E. coli) may yield properly folded but inactive protein

  • The protein may require extremely high temperatures for proper folding

• Equipment limitations:

  • Standard lab equipment may not accommodate high-temperature reactions

  • Consider specialized high-temperature incubators, heat blocks, and thermocyclers

• Experimental design modifications:

  • Include appropriate controls (other thermostable proteins)

  • Design time-course experiments to account for different reaction kinetics at high temperatures

  • Consider specialized equipment for hyperthermophilic assays

How can I optimize the expression and purification of recombinant PH2001 in E. coli?

Optimizing the expression and purification of thermophilic proteins in mesophilic hosts requires careful consideration:

Expression optimization:

Purification strategy:

• Initial capture: Utilize His-tag affinity purification with Ni-NTA resin

• Heat treatment: Exploit thermostability by heating cell lysate (70-80°C for 15-30 min) to precipitate E. coli proteins

• Secondary purification: Use ion exchange chromatography based on theoretical pI

• Polishing step: Size exclusion chromatography to achieve high purity

• Quality control: Verify purity by SDS-PAGE (>90% purity) and assess activity using pilot assays

What approaches should be used to predict the function of PH2001 based on sequence and structural data?

A comprehensive approach to predicting PH2001 function should combine multiple computational and experimental methods:

Sequence-based analysis:

• Sequence similarity searches against characterized proteins

• Identification of conserved domains and motifs

• Genomic context analysis (gene neighborhoods)

• Phylogenetic profiling to identify co-occurrence patterns

Structure-based analysis:

• Structure prediction using AlphaFold2 or similar tools

• Structural similarity searches against PDB database

• Active site prediction and substrate docking

• Molecular dynamics simulations to assess flexibility and potential binding interfaces

Integrative analysis:

• Combine sequence and structural predictions

• Cross-reference with experimental data from similar proteins

• Develop multiple hypotheses for potential functions

• Design targeted experiments to test each hypothesis

How can I determine if recombinant PH2001 is properly folded?

Assessing proper folding of recombinant PH2001 requires multiple complementary approaches:

Biophysical characterization methods:

Thermal stability assessment:
Given PH2001's origin from a hyperthermophile, properly folded protein should demonstrate exceptional thermal stability:

• Monitor activity or structural parameters at increasing temperatures

• Perform thermal shift assays to determine melting temperature

• Compare stability to known thermostable proteins as positive controls

What mass spectrometry approaches are most suitable for studying uncharacterized proteins like PH2001?

Mass spectrometry (MS) offers powerful tools for characterizing uncharacterized proteins through several complementary approaches:

Protein identification and validation:

• Peptide mass fingerprinting to confirm protein identity

• Bottom-up proteomics with LC-MS/MS to verify sequence coverage

• Top-down proteomics to detect post-translational modifications

Structural characterization:

• Hydrogen-deuterium exchange MS (HDX-MS) to probe structural dynamics

• Cross-linking MS to identify spatial relationships between residues

• Native MS to determine oligomeric state and complex formation

Functional analysis:

• Activity-based protein profiling to identify enzymatic functions

• Ligand binding studies using MS to detect substrate interactions

• Protein-protein interaction analysis through affinity purification-MS

Sample preparation considerations for thermophilic proteins:

• Use higher denaturation temperatures for complete unfolding

• Consider specialized proteases stable at higher temperatures

• Incorporate appropriate controls for temperature-dependent modifications

How should I structure data tables when analyzing experimental results from PH2001 studies?

Properly structured data tables are essential for capturing, analyzing, and communicating research findings. For PH2001 studies, consider the following framework:

General principles for data table design:

• Identify independent and dependent variables clearly

• Use consistent units and formatting throughout

• Include all relevant experimental conditions

• Provide statistical measures (mean, standard deviation, etc.)

• Use clear, informative headers and labels15

Example data table structure for thermal stability analysis:

Documentation considerations:

• Include detailed experimental conditions in table footnotes

• Reference specific methodologies used for measurements

• Ensure data tables can stand alone when separated from the main text

• Consider using typologically ordered tables for comparing different experimental conditions

How can I handle small sample sizes in experiments with recombinant proteins?

When working with specialized proteins like PH2001, limited material or technical constraints may lead to small sample sizes. Here's how to handle this methodologically:

Study design optimization:

• Use within-subject designs when possible to reduce variability

• Employ randomization and blinding to minimize bias

• Conduct power analyses to determine minimum required sample size

• Consider sequential analysis approaches to optimize sampling

Data quality and validation:

• Implement rigorous quality control measures

• Use replication to verify critical findings

• Document all data points, including outliers

• Validate findings using complementary techniques

Statistical approaches for small samples:

• Use non-parametric tests when normality cannot be assumed

• Apply bootstrap or resampling methods to estimate confidence intervals

• Consider Bayesian approaches that can incorporate prior knowledge

• Be cautious about over-interpretation of borderline significant results

Reporting considerations:

• Clearly acknowledge sample size limitations

• Report effect sizes alongside p-values

• Provide raw data when possible

• Discuss potential sources of variability

How do I resolve contradictory results when characterizing an uncharacterized protein?

When faced with contradictory results during PH2001 characterization, follow this systematic approach:

Step 1: Data validation

• Verify experimental conditions and protocols

• Check for technical artifacts or systematic errors

• Reproduce key experiments with appropriate controls

• Evaluate whether differences are statistically significant

Step 2: Identify potential explanations

• Different experimental conditions (temperature, pH, buffer composition)

• Post-translational modifications or alternative conformations

• Presence of inhibitors or activators

• Oligomerization state differences

Step 3: Design discriminating experiments

• Create experiments specifically designed to test competing hypotheses

• Vary one parameter at a time to isolate causative factors

• Use orthogonal techniques to validate findings

Step 4: Integrate findings

• Consider whether contradictions reflect genuine biological complexity

• Develop a model that accounts for context-dependent behavior

• Document conditions under which different results are observed

What comparative genomics approaches can help elucidate the function of PH2001?

Comparative genomics provides powerful tools for investigating uncharacterized proteins through evolutionary context:

Phylogenetic profiling:

• Identify orthologs across diverse species

• Create presence/absence patterns across phylogenetic trees

• Look for co-occurrence with proteins of known function

• Infer potential functional relationships from similar distribution patterns

Genomic context analysis:

• Examine gene neighborhood conservation

• Identify operons or co-regulated gene clusters

• Look for fusion events with domains of known function

• Analyze synteny patterns across related genomes

Evolutionary rate analysis:

• Calculate sequence conservation rates across orthologs

• Identify highly conserved residues (potential functional sites)

• Compare evolutionary constraints with related protein families

• Use evolutionary coupling analysis to predict residue interactions

Methodological workflow:

• Identify PH2001 homologs using sensitive sequence search tools (PSI-BLAST, HMMer)

• Construct multiple sequence alignments

• Build phylogenetic trees to establish evolutionary relationships

• Map genomic context information onto phylogenetic trees

• Integrate findings to generate functional hypotheses

How can structural biology approaches be applied to elucidate the function of PH2001?

Structural biology provides crucial insights into protein function through detailed 3D structure analysis:

Experimental structure determination approaches:

Structure-based function prediction:

• Structural similarity searches against known protein structures

• Active site identification and comparison with characterized enzymes

• Molecular docking with potential substrates

• Molecular dynamics simulations to identify functional motions

Structure-guided mutagenesis:

• Identify conserved or potentially functional residues

• Design alanine scanning or targeted mutations

• Test mutant proteins for altered activity or stability

• Use structure-based rationale to interpret results

Integration with other data:

• Map evolutionary conservation onto structural models

• Identify potential interaction surfaces

• Correlate structural features with biochemical data

• Use structure to guide experimental design

What are the most promising applications for thermostable uncharacterized proteins like PH2001?

Thermostable proteins from extremophiles like P. horikoshii offer unique advantages for various applications:

Enzyme biotechnology:

• Industrial catalysts for high-temperature processes

• Increased reaction rates at elevated temperatures

• Extended catalyst lifetimes due to inherent stability

• Resistance to organic solvents and denaturation

Structural biology tools:

• Model systems for studying protein folding and stability

• Templates for protein engineering and design

• Reference structures for computational modeling

Therapeutic applications:

• Enhanced shelf-life for protein-based therapeutics

• Resistance to proteolytic degradation

• Novel drug targets specific to archaeal pathogens

• Scaffolds for thermostable antibody engineering

Research reagents:

• Heat-stable alternatives to mesophilic enzymes

• Components for high-temperature PCR and molecular biology

• Standards for thermal stability measurements

Experimental advantages of working with PH2001:

• Can be purified using heat treatment steps

• Likely maintains stability during long-term storage

• May function under conditions that denature contaminants

• Provides insights into extreme adaptation mechanisms

What are the most common issues when working with recombinant PH2001 protein and how can they be addressed?

Researchers working with recombinant hyperthermophilic proteins like PH2001 frequently encounter several challenges:

Expression issues:

Solubility and stability challenges:

• Issue: Protein precipitation during concentration
  Solution: Add stabilizing agents (glycerol, arginine), optimize buffer conditions, concentrate at lower temperatures

• Issue: Activity loss during storage
  Solution: Identify optimal storage buffer, add stabilizing agents, aliquot to avoid freeze-thaw cycles

• Issue: Inconsistent activity measurements
  Solution: Standardize assay conditions, ensure proper folding, control temperature precisely

Functional characterization obstacles:

• Issue: No detectable activity
  Solution: Try diverse substrate panels, vary assay conditions (temperature, pH, cofactors), consider protein partners

• Issue: Non-physiological behavior at standard temperatures
  Solution: Perform assays at elevated temperatures, consider native environment conditions

• Issue: Difficulty distinguishing specific from non-specific activity
  Solution: Include proper controls, perform inhibition studies, use structure-guided mutations

How can researchers overcome challenges in identifying binding partners or substrates for uncharacterized proteins?

Identifying interaction partners for uncharacterized proteins requires systematic approaches:

Computational prediction strategies:

• Structural docking with compound libraries

• Analysis of surface characteristics and potential binding pockets

• Sequence-based interaction prediction using machine learning

• Co-evolution analysis to identify correlated mutation patterns

Experimental screening approaches:

Validation strategies:

• Confirm interactions using multiple orthogonal methods

• Perform control experiments with mutated binding sites

• Quantify binding parameters (Kd, kon, koff)

• Demonstrate specificity through competition assays

What emerging technologies hold promise for characterizing proteins like PH2001?

Several cutting-edge technologies are revolutionizing the study of uncharacterized proteins:

AI and deep learning applications:

• AlphaFold2 and RoseTTAFold for accurate structure prediction

• Machine learning for function prediction from sequence

• AI-guided experimental design for efficient characterization

• Automated literature mining to connect disparate information

Advanced structural methods:

• Time-resolved crystallography to capture conformational changes

• MicroED for structure determination from nanocrystals

• Integrative structural biology combining multiple data types

• Serial crystallography at X-ray free electron lasers

Single-molecule approaches:

• Single-molecule FRET to monitor conformational dynamics

• Nanopore analysis for protein unfolding studies

• Force spectroscopy to measure mechanical stability

• Single-molecule tracking in cellular contexts

High-throughput functional screening:

• Droplet microfluidics for massive parallelization

• CRISPR-based functional genomics screens

• Massively parallel activity assays with DNA barcoding

• Cell-free expression systems for rapid testing

Integration with other 'omics data:

• Systems biology approaches combining multiple data types

• Proteogenomics to connect genomic and proteomic information

• Metabolomics to identify potential substrates or products

How might the study of uncharacterized proteins contribute to our understanding of extremophile biology?

Research on uncharacterized proteins from extremophiles provides unique insights into fundamental biological questions:

Evolutionary adaptations:

• Molecular basis of thermostability and other extreme adaptations

• Convergent vs. divergent evolution strategies in extreme environments

• Ancient protein families and their evolutionary trajectories

• Minimal functional requirements under extreme conditions

Biochemical principles:

• Structure-function relationships under extreme conditions

• Novel catalytic mechanisms adapted to extreme environments

• Protein folding and stability principles

• Alternative bioenergetic pathways

Biotechnological applications:

• New catalysts for industrial processes

• Biomaterials with enhanced stability

• Novel antimicrobials targeting archaeal-specific pathways

• Enzymes for extreme reaction conditions

Astrobiology implications:

• Understanding potential extraterrestrial life adaptations

• Biomarkers for detecting life in extreme environments

• Limits of life under extreme conditions

• Primitive protein functions and early evolution

What are the most valuable databases and tools for researchers studying uncharacterized proteins?

Researchers working with uncharacterized proteins should utilize these specialized resources:

Sequence databases and tools:

• UniProt/Swiss-Prot: Curated protein information (PH2001: O57781)

• InterPro: Integrated resource for protein families and domains

• Pfam: Protein family database

• HMMER: Sensitive sequence search using hidden Markov models

Structure prediction and analysis:

• AlphaFold DB: Database of predicted protein structures

• PDB: Repository of experimental protein structures

• DALI: Structural comparison server

• ConSurf: Evolutionary conservation mapping onto structures

Functional prediction:

• BLAST: Sequence similarity search

• STRING: Protein-protein interaction networks

• eggNOG: Orthology relationships and functional annotations

• ProFunc: Function prediction from structure

Extremophile-specific resources:

• ExtremeDB: Database of extremophilic proteins

• PROSS: Computational protein stabilization tool

• ThermoProt: Thermophilic protein database

• Archaea-specific genome databases

Experimental design resources:

• PDB statistics for crystallization conditions

• Thermofluor protocols for thermal stability analysis

• Archaeal expression system protocols

• High-temperature assay methodologies

What key publications should researchers reference when working with uncharacterized archaeal proteins?

Essential literature for researchers working with uncharacterized archaeal proteins includes:

Methodological references:

• "Annotation and curation of uncharacterized proteins- challenges" (2015) - Provides systematic approaches for characterizing hypothetical proteins

• "Improving the success rate of proteome analysis by modeling protein-abundance distributions and experimental designs" (2007) - Offers strategies for optimizing experimental design for challenging proteins

• "Using tables to enhance trustworthiness in qualitative research" (2021) - Guidelines for effectively presenting research data

Hyperthermophile-specific literature:

• "Molecular adaptations of extremophiles to temperature and pressure"

• "Structural basis of thermostability in hyperthermophilic proteins"

• "Enzymes from extremophiles: From fundamentals to industrial applications"

Archaeal biology references:

• "The third domain: The untold story of Archaea"

• "Archaea: Evolution, Physiology, and Molecular Biology"

• "Genomics and evolution of Thermophilic Archaea"

Functional genomics approaches:

• "Integrative approaches for predicting protein function"

• "Systems biology approaches for studying archaeal biology"

• "Comparative genomics in archaeal research: From genomes to function"