Recombinant Pyrococcus horikoshii UPF0056 membrane protein PH0214 (PH0214)

What is Pyrococcus horikoshii UPF0056 membrane protein PH0214?

Pyrococcus horikoshii UPF0056 membrane protein PH0214 is a 202-amino acid integral membrane protein from the hyperthermophilic archaeon Pyrococcus horikoshii strain ATCC 700860/DSM 12428/JCM 9974/NBRC 100139/OT-3. The protein is characterized by a distinct amino acid sequence (mLKEILSSALLmLIMIDPSDKILLVSLLREDFHIEDVKSLIIRANLIGFILLLLFAVAGK IILQDIFHIELDALRVAGGFVLFKIGLEALEGGGMVTIKREKNILALAAVPVATPLIAGP AAITAAITLTAEHGIIVSIVGTLIAIAITAALMMIALYLMRGISKTALSVTIRIIGLFIM AIGAQMMITGAGGIVLNLIKGA) and belongs to the UPF0056 protein family . This protein, represented by UniProt accession number O57953, is of interest to researchers studying membrane protein structure, function, and evolution in extremophilic organisms.

What expression systems are most suitable for PH0214 recombinant production?

The selection of an appropriate expression system for PH0214 requires careful consideration of several factors. While Escherichia coli remains the most commonly used host for recombinant protein production, membrane proteins often present specific challenges including inclusion body formation, toxicity to the host, and inefficient translocation .

For PH0214 expression, researchers should consider:

• Expression host optimization: While E. coli BL21 strains are common starting points, engineered strains with reduced acetate production (like ackA mutants) have shown improved yields for membrane proteins .

• Vector system selection: Balance between promoter strength and plasmid copy number is crucial. For membrane proteins like PH0214, a lower copy number origin of replication (such as p15A) combined with a moderate-strength inducible promoter (such as Ptac or PBAD) often provides better results than high-copy vectors with strong promoters like PT7 .

• Growth conditions: Culture at lower temperatures (16-30°C) after induction and use of specialized media formulations can improve folding and stability.

• Solubilization strategies: Proper selection of detergents for membrane protein extraction is critical for maintaining native structure.

What are the optimal storage conditions for recombinant PH0214?

Recombinant PH0214 protein stability is maximized in Tris-based buffer with 50% glycerol . For long-term storage, the protein should be kept at -20°C to -80°C to prevent degradation. Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and aggregation .

For researchers working with this hyperthermophilic protein, it's worth noting that the native organism P. horikoshii grows optimally at temperatures around 95-100°C, suggesting that the protein has evolved for stability at high temperatures. This intrinsic thermostability may provide advantages during purification and characterization experiments.

How can computational approaches be used to design soluble analogues of PH0214?

Recent advances in protein design provide promising avenues for creating soluble analogues of membrane proteins like PH0214. Researchers can employ deep learning pipelines to transform the integral membrane structure into a soluble form while maintaining the core structural features . The methodology involves:

This approach has shown remarkable success with complex membrane protein topologies, including G-protein-coupled receptors, producing stable soluble proteins that maintain the structural features of their membrane-bound counterparts . These soluble analogues can significantly facilitate structural and functional studies without the complications of detergent solubilization.

What strategies can overcome inclusion body formation when expressing PH0214?

Inclusion body formation is a common challenge when expressing membrane proteins like PH0214. Researchers can implement several methodological approaches to enhance soluble expression:

• Co-expression with chaperones: Introduce plasmids encoding chaperone proteins (such as GroEL/GroES, DnaK/DnaJ/GrpE, or membrane-specific chaperones) to assist with proper folding.

• Fusion tags optimization: Test multiple fusion partners systematically, including:

  • Solubility enhancers: MBP, GST, SUMO, TrxA

  • Specialized membrane protein tags: Mistic, NYIO

• Induction optimization matrix:

• Expression media optimization: Supplement with components that can stabilize membrane proteins:

  • Osmolytes (glycerol, betaine)

  • Specific ions relevant to protein function

  • Mild detergents (0.05% Triton X-100)

• Translocation enhancement: For membrane proteins, co-expression of components of the Sec or Tat translocation pathways can improve proper membrane insertion.

• Metabolic engineering approaches: Use strains with reduced acetate production and optimized energy metabolism to reduce metabolic burden during expression .

What analytical techniques are most informative for characterizing PH0214 structure and function?

A comprehensive characterization of PH0214 requires complementary biophysical and biochemical approaches:

• Structural analysis techniques:

  • Cryo-electron microscopy (cryo-EM) for high-resolution structure determination

  • NMR spectroscopy for dynamics and ligand binding studies

  • X-ray crystallography (if crystals can be obtained)

  • Small-angle X-ray scattering (SAXS) for solution structure analysis

• Stability and folding assessment:

  • Circular dichroism (CD) spectroscopy for secondary structure content

  • Differential scanning calorimetry (DSC) for thermal stability measurements

  • Fluorescence spectroscopy to monitor tertiary structure

• Functional characterization:

  • Liposome reconstitution assays for transport studies

  • Electrophysiology for channel activity measurement (if applicable)

  • Binding assays for interaction partners

  • Mutational analysis of conserved residues

• Computational approaches:

  • Molecular dynamics simulations of membrane embedding

  • Sequence-based prediction of functional sites

  • Evolutionary analysis for functional inference

How should researchers design expression vectors for optimal PH0214 production?

The design of expression vectors for PH0214 requires careful consideration of multiple factors to balance protein production with host cell viability:

• Promoter selection: Finding the optimal promoter strength is crucial. While T7 promoters offer high expression levels, they often lead to inclusion body formation for membrane proteins. A comparison of different promoter systems reveals:

• Origin of replication: Plasmid copy number significantly impacts expression outcomes. Lower copy number origins like p15A often provide better results for membrane proteins than high copy number origins like pMB1 .

• Codon optimization: Adapt the coding sequence to the expression host's codon usage, but avoid rare codons at critical folding positions.

• Fusion tag placement: For membrane proteins, N-terminal tags are often more accessible than C-terminal tags. Include protease cleavage sites for tag removal.

• Secretion signals: Consider adding appropriate signal sequences for membrane localization or periplasmic targeting in E. coli.

• Ribosome binding site (RBS) engineering: Optimize the RBS strength to control translation initiation rate, which can improve folding outcomes.

Researchers should develop a systematic strategy to test multiple vector configurations, as the optimal system may need to be determined empirically for each specific membrane protein .

What are the critical factors for successful purification of functional PH0214?

Purification of functional PH0214 requires careful attention to maintaining the native structure throughout the isolation process:

• Membrane extraction optimization:

  • Test a panel of detergents (DDM, LMNG, OG, CHAPS) at different concentrations

  • Evaluate extraction efficiency and protein stability in each detergent

  • Consider native lipid co-extraction to stabilize the protein

• Purification strategy development:

  • Implement a multi-step purification approach:
    a. Affinity chromatography (IMAC for His-tagged protein)
    b. Size exclusion chromatography to remove aggregates
    c. Ion exchange chromatography for final polishing

  • Monitor protein homogeneity at each step using SDS-PAGE and Western blotting

• Buffer optimization matrix:

• Quality control assessments:

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to confirm monodispersity

  • Thermal shift assays to measure stability under different conditions

  • Activity assays to confirm functional state

• Reconstitution approaches:

  • Nanodiscs for a more native-like membrane environment

  • Proteoliposomes for functional studies

  • Amphipols for enhanced stability during structural studies

How can researchers assess the functional characteristics of PH0214?

Since the specific function of UPF0056 family proteins like PH0214 is not fully characterized, a systematic approach to functional assessment is necessary:

• Comparative genomic analysis:

  • Identify conserved domains and sequence motifs

  • Map conservation onto structural models

  • Predict function through association with operons or genetic context

• Structural homology assessment:

  • Compare with known membrane protein structures

  • Identify potential binding pockets or channels

  • Map electrostatic surface potential to infer function

• Experimental functional screening:

  • Transport assays using fluorescent substrates

  • Ligand binding studies with potential metabolites

  • Protein-protein interaction mapping

• Site-directed mutagenesis strategy:

  • Target conserved residues for alanine scanning

  • Modify predicted functional sites

  • Create chimeric proteins with known functional domains

• In vivo complementation studies:

  • Express PH0214 in model organisms lacking related proteins

  • Assess phenotypic rescue capabilities

  • Monitor changes in cellular physiology

How should researchers interpret thermal stability data for proteins from hyperthermophiles like P. horikoshii?

Interpreting thermal stability data for hyperthermophilic proteins requires specialized considerations:

• Temperature range adjustment: Standard thermal denaturation protocols often use temperatures up to 95°C, but proteins from P. horikoshii may require extended ranges up to 120°C using pressurized systems.

• Reference frame establishment: Compare stability measurements to mesophilic homologues to establish relative stability metrics rather than absolute temperatures.

• Buffer effects assessment: The stabilizing effects of buffers and additives may differ significantly at extremely high temperatures. Systematic testing is required:

• Kinetic versus thermodynamic stability: Distinguish between resistance to unfolding (thermodynamic stability) and slow unfolding rates (kinetic stability) through time-dependent measurements.

• Oligomeric state monitoring: Changes in quaternary structure can precede unfolding and should be monitored in parallel with secondary/tertiary structure measurements.

• Reversibility assessment: Unlike many mesophilic proteins, some hyperthermophilic proteins display remarkable refolding capabilities after thermal denaturation, which should be quantified.

What computational approaches can predict membrane topology and structure of PH0214?

Several computational methods can be employed to predict and model the membrane topology and structure of PH0214:

• Transmembrane topology prediction:

  • TMHMM, MEMSAT, and Phobius for transmembrane helix prediction

  • SignalP for signal peptide detection

  • TOPCONS for consensus topology mapping

• Ab initio structure prediction:

  • AlphaFold2 and RoseTTAFold for initial structure generation

  • Specialized membrane protein prediction servers (FILM3)

  • Refinement in explicit membrane environments

• Molecular dynamics simulations:

  • Equilibration in realistic membrane models

  • Assessment of stability and conformational flexibility

  • Lipid-protein interaction mapping

• Evolutionary coupling analysis:

  • Contact prediction through co-evolution analysis

  • Functional site identification

  • Structural restraint generation for modeling

• Integration with experimental data:

  • Incorporation of crosslinking constraints

  • Validation with limited proteolysis data

  • Refinement using low-resolution structural data

These computational approaches can generate testable hypotheses about protein structure and function, guiding experimental design and interpretation .

How can PH0214 be functionalized for biotechnology applications?

The exceptional stability of proteins from hyperthermophiles like P. horikoshii makes them attractive candidates for biotechnological applications. PH0214 can be functionalized through:

• Domain fusion approaches:

  • Creating chimeric proteins with functional domains from other membrane proteins

  • Engineering binding sites for specific ligands or molecules

  • Developing biosensor applications through reporter domain fusion

• Stability transfer strategies:

  • Identifying stability-enhancing features from PH0214

  • Transferring these elements to less stable membrane proteins

  • Creating thermostable variants of industrially relevant proteins

• Soluble analogue development:

  • Computational redesign of PH0214 into soluble forms

  • Functionalization with native structural motifs

  • Application in drug discovery and protein engineering

• Scaffold engineering:

  • Using the stable fold as a platform for presenting peptides or functional groups

  • Creating novel binding proteins through directed evolution

  • Developing enzyme-like functions through active site design

What are the challenges in reproducing native PH0214 function in heterologous expression systems?

Reproducing the native function of PH0214 in laboratory settings presents several challenges:

• Environmental discrepancies:

  • P. horikoshii's native environment (95-100°C, high pressure) differs dramatically from laboratory conditions

  • Hyperthermophilic proteins often require extreme conditions for proper folding and function

  • Heterologous expression may lack specific chaperones or folding factors

• Membrane composition differences:

  • Archaeal membranes contain ether-linked lipids rather than ester-linked phospholipids found in bacteria and eukaryotes

  • Lipid composition affects membrane protein folding, stability, and function

  • Reconstitution in native-like lipid environments may be necessary

• Post-translational modification variations:

  • Archaeal proteins may undergo unique post-translational modifications

  • Heterologous systems may lack the necessary modification machinery

  • Function may depend on specific modifications

• Interacting partner absence:

  • Membrane proteins often function in complexes or with specific interacting partners

  • Related proteins from the native organism may be required for function

  • Co-expression of multiple components might be necessary

• Experimental condition optimization:

  • Standard assay conditions may not be appropriate for hyperthermophilic proteins

  • Development of high-temperature, high-pressure functional assays may be required

  • Novel analytical approaches might be needed for accurate functional assessment

What are the emerging technologies that will advance PH0214 research?

The study of membrane proteins like PH0214 will benefit from several emerging technologies:

• Cryo-EM advances: Improvements in resolution and sample preparation techniques are making it possible to determine structures of smaller membrane proteins without crystallization.

• Deep learning applications: AI-based approaches for protein structure prediction, design, and functional annotation will accelerate research on poorly characterized proteins like PH0214 .

• Single-molecule techniques: Methods for studying individual protein molecules can reveal dynamic properties and rare conformational states relevant to function.

• Native mass spectrometry: Advanced MS techniques can analyze intact membrane protein complexes with their associated lipids and cofactors.

• Microfluidic platforms: High-throughput screening of conditions for expression, purification, and functional characterization will accelerate discovery.

• Synthetic biology approaches: Designer expression systems with precisely controlled gene expression and tailored cellular environments will improve production of challenging membrane proteins .

• Computational design tools: The ability to create soluble analogues of membrane proteins will enable easier structural and functional studies, as well as new applications in biotechnology and medicine .

How do the properties of PH0214 compare with other membrane proteins from extremophiles?

A comparative analysis of PH0214 with other extremophile membrane proteins reveals important insights:

The comparison highlights the unique adaptations of PH0214 to extreme temperatures and provides context for understanding the molecular basis of protein stability in harsh environments. This knowledge can inform biotechnological applications and fundamental understanding of protein structure-function relationships.