Recombinant Pyrococcus horikoshii UPF0056 membrane protein PH0760 (PH0760)

Shipped with Ice Packs
In Stock

Description

Basic Identification

PropertyDetailsSources
Uniprot IDO58499 (PH0760) or O57899 (PH_RS00730)
Gene LocusPH0760 (PHCI026 ORF)
OrganismPyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Length201 amino acids (aa) or 177 aa (PH_RS00730)
Molecular WeightNot explicitly reported (estimated ~22–24 kDa based on length)N/A

Notes:

  • The Uniprot IDs and sequence lengths vary across sources, suggesting potential discrepancies in database entries or isoforms.

  • The protein is annotated as part of the UPF0056 family, a group of uncharacterized proteins with predicted membrane localization.

Amino Acid Sequence

Two distinct sequences are reported in literature:

SourceSequence (Partial)Notes
mLEAIKTFMILYTGMFAITNPIGAVPVFMSVVGHLPAEIKHEVAKKVSITVFITLTVFAL... (1–201 aa)Includes a putative transmembrane domain (e.g., hydrophobic stretches).
MRFKVSKLMAYILRHSPWEFGLEPDEEGFVSIEELVNAVRKVYPWVTEEYIREIVERDEKGR... (1–177 aa)Diverges significantly from the other sequence, possibly due to gene locus differences.

Key Challenges:

  • Solubility: Native membrane proteins often require detergents or stabilizing agents (e.g., glycerol) for proper folding .

  • Structural Analysis: No crystallographic or cryo-EM data are available in public databases (e.g., PDB, mpstruc) .

Research Gaps and Future Directions

  1. Functional Annotation:

    • UPF0056 proteins remain poorly characterized. Hypothetical roles include membrane transport or signaling.

  2. Structural Elucidation:

    • MPEx or mpstruc tools could classify PH0760 as α-helical or β-barrel, aiding functional inference .

  3. Therapeutic Potential:

    • Membrane proteins like PH0760 may serve as targets for antimicrobial therapies, given Pyrococcus horikoshii’s extremophilic nature.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify it in your order remarks. We will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
PH0760; PHCI026; UPF0056 membrane protein PH0760
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Target Names
PH0760
Target Protein Sequence
MLEAIKTFMILYTGMFAITNPIGAVPVFMSVVGHLPAEIKHEVAKKVSITVFITLTVFAL VGQWIFKFFGSSIDAFAIAGGILLFRMGMEMLSGKLSSVKIDEEDVTLEEVAVIPLAIPL ISGPGAITTVMLYMTKESPGIVILTIIAIGLTTYGILYSGNKIIERLGRVGVKVTTRMMG LILTSMAMQMIINGIKGAFGI
Uniprot No.

Target Background

Database Links

KEGG: pho:PH0760

STRING: 70601.PH0760

Protein Families
UPF0056 (MarC) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Pyrococcus horikoshii UPF0056 membrane protein PH0760?

PH0760 is a membrane protein from the hyperthermophilic archaeon Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3). It belongs to the UPF0056 protein family, with 201 amino acids in its full-length sequence. The protein is encoded by the gene PH0760 (also known as PHCI026) and is identified in UniProtKB with the accession number O58499 . As a membrane protein from an extremophile organism, it likely plays a role in membrane integrity under extreme conditions, though specific biological functions remain under investigation.

What structural data is available for PH0760?

A high-confidence computational structural model of PH0760 is available through AlphaFold DB (AF-O58499-F1). This model was released on December 9, 2021, and last modified on September 30, 2022. It demonstrates exceptional confidence with a global pLDDT score of 91.66, indicating very high model reliability . The predicted structure provides insights into the protein's membrane topology and potential functional domains, though it should be noted that this is a computational model without experimental verification through traditional methods such as X-ray crystallography or cryo-EM.

What is the amino acid sequence of PH0760?

The complete amino acid sequence of PH0760 is: mLEAIKTFMILYTGMFAITNPIGAVPVFMSVVGHLPAEIKHEVAKKVSITVFITLTVFALVGQWIFKFFGSSIDAFAIAGGILLFRMGMEmLSGKLSSVKIDEEDVTLEEVAVIPLAIPLISGPGAITTVmLYMTKESPGIVILTIIAIGLTTYGILYSGNKIIERLGRVGVKVTTRMMGLILTSMAMQMIINGIKGAFGI . Analysis of this sequence reveals multiple hydrophobic regions consistent with transmembrane domains, which supports its classification as a membrane protein. The sequence also contains several conserved motifs characteristic of the UPF0056 family.

How should recombinant PH0760 be optimally stored for research?

For optimal stability, recombinant PH0760 should be stored at -20°C for regular use, or at -80°C for extended storage periods. The protein is typically supplied in a Tris-based buffer with 50% glycerol that has been optimized for maintaining protein stability . For working experiments, it is recommended to create small aliquots that can be stored at 4°C for up to one week, thus avoiding degradation from repeated freeze-thaw cycles. This approach minimizes protein denaturation and preserves functional activity for experimental applications.

What expression systems are suitable for producing recombinant PH0760?

While the search results don't specify the expression system used for commercial production, proteins from hyperthermophilic archaea like P. horikoshii typically require specialized expression systems. E. coli-based systems with heat-shock promoters or cold-adapted expression hosts can be employed, though codon optimization may be necessary. For functional studies requiring proper membrane insertion, eukaryotic expression systems such as yeast (P. pastoris) or insect cells may yield better results. The choice depends on research objectives—structural studies might prioritize yield, while functional assays require proper folding and membrane integration.

What purification strategies are most effective for recombinant PH0760?

Effective purification of recombinant PH0760 typically involves a multi-step process starting with cell lysis under conditions that preserve protein structure. For membrane proteins like PH0760, detergent solubilization (using mild detergents like DDM or CHAPS) is crucial for extraction from membranes. Affinity chromatography using the attached tag (specific tag information is determined during the production process ) provides initial purification, followed by size exclusion chromatography to remove aggregates and ensure homogeneity. For highest purity, ion exchange chromatography may be implemented as a polishing step. Throughout purification, maintaining a temperature close to 4°C helps prevent degradation.

How can researchers validate the proper folding of recombinant PH0760?

Validating proper folding of recombinant PH0760 requires a multi-technique approach. Circular dichroism (CD) spectroscopy can assess secondary structure content, particularly important for comparing recombinant protein to predicted structures from AlphaFold (pLDDT score 91.66 ). Thermal denaturation studies using differential scanning calorimetry (DSC) can verify thermostability expected from a hyperthermophilic organism. For tertiary structure assessment, intrinsic tryptophan fluorescence and limited proteolysis can provide information about the accessibility of specific residues. Ultimately, functional assays specific to membrane proteins (such as reconstitution into liposomes and permeability studies) offer the most definitive validation of proper folding.

What strategies should be employed to study PH0760 interactions with other proteins?

Given that PH0760's functional partners remain largely uncharacterized, a multipronged approach is necessary. Pull-down assays using the recombinant protein as bait can identify binding partners from P. horikoshii lysates. Surface plasmon resonance (SPR) or microscale thermophoresis (MST) provide quantitative binding kinetics for candidate interactions. For membrane-contextual interactions, chemical cross-linking followed by mass spectrometry can capture transient interactions. Computational approaches using the AlphaFold structure to predict protein-protein interaction interfaces, followed by targeted mutagenesis of these regions, can validate in silico predictions. Yeast two-hybrid or bacterial two-hybrid systems modified for membrane proteins might also reveal interaction partners.

How does the thermostability of PH0760 compare to mesophilic homologs?

As a protein from the hyperthermophilic archaeon P. horikoshii, PH0760 is expected to exhibit exceptional thermostability compared to mesophilic homologs. Comparative analysis would involve thermal denaturation studies using differential scanning calorimetry or thermal shift assays. Typically, proteins from Pyrococcus species retain structure and function at temperatures exceeding 80°C. Molecular determinants of this thermostability likely include increased ionic interactions, more extensive hydrophobic packing, reduced loop regions, and higher proportions of amino acids that contribute to structural rigidity. The AlphaFold structural model (pLDDT 91.66 ) can be analyzed for these features through comparison with mesophilic UPF0056 family members.

What experimental approaches can determine the membrane topology of PH0760?

Determining the membrane topology of PH0760 requires complementary experimental approaches. Protease protection assays, where the protein is reconstituted into liposomes and treated with proteases, can identify exposed regions. Substituted cysteine accessibility method (SCAM) involves introducing cysteine residues at various positions and assessing their accessibility to membrane-impermeant thiol reagents. Fluorescence quenching experiments with environment-sensitive probes can identify membrane-embedded regions. For higher resolution, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map solvent-accessible regions. These experimental data should be compared with computational predictions based on the AlphaFold model (pLDDT 91.66 ) and hydrophobicity analysis of the sequence.

How can researchers assess the ion channel or transporter activity of PH0760?

To assess potential ion channel or transporter activity of PH0760, the protein must first be reconstituted into proteoliposomes or planar lipid bilayers. Subsequent functional assays include flux measurements using fluorescent indicators for specific ions, patch-clamp electrophysiology to measure current flow, or radiolabeled substrate transport assays. For high-throughput screening, solid-supported membrane (SSM)-based electrophysiology can detect charge movements associated with transport events. The choice of lipid composition for reconstitution is critical and should mimic the native archaeal membrane environment, potentially including archaeal-specific lipids with ether linkages rather than ester linkages found in bacterial and eukaryotic membranes.

What computational tools are most useful for predicting PH0760 function?

Given the limited functional annotation of PH0760, computational prediction is valuable. Structure-based approaches starting with the AlphaFold model (pLDDT 91.66 ) include cavity analysis to identify potential binding pockets, electrostatic surface mapping to predict interaction with charged molecules, and molecular docking to explore potential ligands. Sequence-based approaches include identifying conserved motifs within the UPF0056 family and comparing with distantly related proteins of known function. Genomic context analysis examining neighboring genes in the P. horikoshii genome may reveal functional associations through operonic organization. Protein-protein interaction network prediction using tools like STRING can suggest functional partners based on genomic proximity, co-expression, and co-evolution patterns.

What are the critical considerations for crystallization trials with PH0760?

Crystallization of membrane proteins like PH0760 presents significant challenges. The choice of detergent is critical—generally, detergents with small micelles (such as n-octyl-β-D-glucoside) are preferred for crystallization. Lipidic cubic phase (LCP) crystallization offers an alternative approach that maintains a more native-like environment. Given PH0760's thermophilic origin, crystallization at elevated temperatures (30-40°C) may yield better results than standard room temperature conditions. The protein's stability in various detergents should be assessed prior to crystallization trials using techniques like size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS). High-throughput screening across hundreds of conditions is typically necessary, with subsequent optimization of promising leads by varying protein concentration, temperature, pH, and additives.

How can cryo-EM sample preparation be optimized for PH0760 structural studies?

For cryo-EM studies of PH0760, sample homogeneity is paramount. Size exclusion chromatography immediately before grid preparation can remove aggregates. The choice between detergent micelles, nanodiscs, or amphipols should be guided by preliminary negative-stain EM to assess particle distribution and orientation diversity. For a relatively small membrane protein like PH0760 (201 amino acids ), strategies to increase molecular weight may be necessary—antibody fragments, engineered fusion partners, or reconstitution with larger binding partners can enhance visibility. Grid preparation parameters including blotting time, blotting force, and vitrification temperature should be systematically optimized. The use of graphene oxide or ultrathin carbon support films can help overcome preferred orientation issues common with membrane proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.