Recombinant Pyrococcus horikoshii UPF0252 protein PH0672 (PH0672)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during production.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PH0672; UPF0252 protein PH0672
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Target Names
PH0672
Target Protein Sequence
MKKVSVIIFIVIMLGIGCLNLNESIKETCPRTSNITQAMSCYIPEDFEILKGVAEEIPGG TIEWKIWNILEWEEDHLSYDNNKGSDIILKPSEFIKVGEGVCTDYAVLTAGLLLASNISP VYLMIFHFMEDPTLHAAVAVNISGKLFILDQRLPPKNLDSYLIQFSKLEGKIILFAEMYK VEMKKGRVVVSGRKYLDLSNFGFYPGNISLDMLENLLLSEFQRRTNLFPRIDLKTVLPQG LKERKVWMIKFENFKLFYDDTFVEQYSNFIADEILKNEKIKSDISRYSAFWISIKLEGDD LIVRLFLGR
Uniprot No.

Target Background

Database Links

KEGG: pho:PH0672

STRING: 70601.PH0672

Protein Families
UPF0252 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Pyrococcus horikoshii UPF0252 protein PH0672?

Pyrococcus horikoshii UPF0252 protein PH0672 is a protein encoded by the PH0672 gene in the hyperthermophilic archaeon Pyrococcus horikoshii OT3. This archaeal organism was isolated from a hydrothermal vent and has an optimal growth temperature of approximately 95-100°C. The PH0672 protein belongs to the UPF0252 family, which consists of proteins with unknown function (hence the UPF designation - Uncharacterized Protein Family).

The full-length protein consists of 309 amino acids and has been successfully expressed in recombinant systems, primarily E. coli . The protein's function remains largely uncharacterized, though its presence in an extremophile suggests potential roles in thermostability or adaptation to extreme environments. The complete genome sequence of Pyrococcus horikoshii OT3 was determined in 1998, with a total genome size of 1,738,505 base pairs containing 2,061 open reading frames (ORFs) .

What expression systems are commonly used for recombinant PH0672 production?

The most well-documented expression system for recombinant PH0672 is Escherichia coli. For successful expression in E. coli, the following methodological approaches have been implemented:

  • Vector selection: pET-based expression vectors with T7 promoter systems are commonly used for high-level expression of PH0672 .

  • Affinity tags: N-terminal His-tag fusion has been successfully applied to facilitate purification through immobilized metal affinity chromatography (IMAC) .

  • Expression conditions: Optimized conditions typically include:

    • Induction with IPTG (0.5-1.0 mM)

    • Expression temperature of 30-37°C (lower temperatures may increase solubility)

    • Expression duration of 3-4 hours post-induction

Alternative expression systems that could be considered for PH0672 include:

Expression SystemAdvantagesLimitations
Pichia pastorisPost-translational modifications, high yieldLonger development time
Cell-free systemsRapid expression, suitable for toxic proteinsHigher cost, lower yield
Insect cellsComplex protein folding, post-translational modificationsTechnical complexity, higher cost

For thermostable proteins like those from P. horikoshii, E. coli remains the preferred expression system due to its simplicity and cost-effectiveness, though protein folding issues may occasionally necessitate exploration of alternative systems .

How can the purification of recombinant PH0672 be optimized?

Optimization of PH0672 purification requires a multi-faceted approach addressing both yield and functional integrity. A recommended methodological workflow is:

  • Cell lysis optimization: Given that PH0672 is from a hyperthermophile, heat treatment (65-70°C for 15-20 minutes) of cell lysates can serve as an initial purification step, precipitating most E. coli proteins while PH0672 remains soluble.

  • Affinity chromatography: His-tagged PH0672 can be purified using nickel or cobalt-based resins. Buffer optimization is critical:

    • Include 10-20 mM imidazole in binding buffer to reduce non-specific binding

    • Use stepwise elution with 50, 100, 200, and 300 mM imidazole

    • Consider including 5-10% glycerol to enhance protein stability

  • Intein-based purification: The integration of self-cleaving intein tags offers several advantages:

    • Tag-free protein recovery

    • Mild elution conditions (pH shift to induce self-cleavage)

    • Higher purity in single-step purification

  • Quality assessment: Purity assessment should be performed using:

    • SDS-PAGE (>90% purity standard)

    • Size exclusion chromatography

    • Mass spectrometry validation

The optimal storage conditions for purified PH0672 include Tris-based buffer with 50% glycerol at -20°C for long-term storage, with working aliquots maintained at 4°C for up to one week to avoid repeated freeze-thaw cycles .

What experimental design approaches are most suitable for characterizing PH0672 function?

Characterizing the function of a poorly understood protein like PH0672 requires systematic experimental design. A comprehensive approach includes:

  • Randomized Block Design (RBD) for more controlled experiments:

    • Group experimental units into homogeneous blocks

    • Eliminates differences among blocks from experimental error

    • Appropriate for testing PH0672 function across different substrate concentrations or in the presence of various inhibitors

  • Functional screening approaches:

    ApproachApplication to PH0672Detection Method
    Enzymatic activity assaysScreen for hydrolase, transferase activitiesSpectrophotometric, fluorometric
    Binding partner identificationTwo-hybrid screening, pull-down assaysMass spectrometry
    Structural studiesX-ray crystallography, NMRAtomic resolution structure
    Computational predictionSequence/structure homologyBioinformatic algorithms

How can structural analysis techniques be applied to study PH0672?

Determining the structure of PH0672 requires application of complementary techniques. The methodological approach should include:

As PH0672 is from a hyperthermophile, special attention should be paid to structure-stability relationships that might reveal unique adaptations for extreme environments .

How can contradictions in experimental data about PH0672 be systematically analyzed?

When working with novel proteins like PH0672, contradictory experimental results are common. A systematic approach to resolving these contradictions includes:

  • Contradiction pattern analysis:

    Pattern ClassDescriptionApplication to PH0672 Research
    (2,1,1)Two interdependent items, one contradiction, one ruleBasic activity assay contradictions
    (3,4,2)Three interdependent items, four contradictions, two rulesComplex functional characterization
    (n,m,p)Complex patterns with multiple variablesSystems biology integration
  • Methodological resolution strategies:

    • Repeat experiments with standardized protocols

    • Introduce additional control variables

    • Test hypotheses about specific interactions between experimental conditions

    • Apply Boolean minimization algorithms to identify the minimal set of rules explaining observed contradictions

What protein-protein interaction methods can be used to identify PH0672 binding partners?

Understanding the protein interaction network of PH0672 is critical for functional characterization. Multiple complementary approaches should be employed:

  • Two-hybrid systems:

    • Yeast two-hybrid: Fusion of PH0672 to DNA-binding domain

    • Bacterial two-hybrid: More suitable for thermophilic proteins

    • Split-ubiquitin system: For membrane-associated interactions

  • Cross-linking coupled with mass spectrometry:

    • Chemical cross-linking of PH0672 with interacting proteins

    • Digestion and MS/MS analysis to identify crosslinked peptides

    • Structural mapping of interaction interfaces

How does PH0672 compare to homologous proteins in other extremophilic organisms?

Comparative analysis of PH0672 with homologs provides insights into evolutionary conservation and functional importance. A systematic approach includes:

  • Sequence-based comparison:

    • BLAST analysis against archaeal genomes

    • Multiple sequence alignment of UPF0252 family proteins

    • Identification of conserved residues and motifs

  • Structural comparison, if structures are available:

    FeaturePH0672Homologs in Related OrganismsSignificance
    Fold conservationTo be determinedVarious depending on homologCore functional importance
    Surface residuesTo be determinedOften less conservedAdaptation to environment
    Active siteTo be determinedHighly conserved if functionalCatalytic mechanism
  • Thermostability features comparison:

    • Ion pair networks distribution

    • Hydrophobic core composition

    • Disulfide bond patterns

    • Proline content in loops

  • Functional conservation testing:

    • Heterologous expression of homologs

    • Comparative activity assays under identical conditions

    • Chimeric protein construction to identify functional domains

This comparative approach may reveal whether PH0672 has a unique role in Pyrococcus horikoshii or shares conserved functions with homologs in other extremophiles .

What are the current hypotheses about PH0672 function based on computational predictions?

Several computational approaches have generated hypotheses about PH0672 function that warrant experimental investigation:

  • Structural homology modeling:

    • Threading algorithms suggest structural similarity to proteins involved in:

      • Membrane transport

      • Cell adhesion

      • Signaling

  • Functional hypotheses requiring experimental validation:

    Hypothesized FunctionComputational EvidenceSuggested Experimental Approach
    Membrane transportHydrophobic domains, signal sequenceLiposome reconstitution, transport assays
    Cell surface attachmentSimilarity to adhesion motifsCell binding assays, force microscopy
    Stress responseCo-expression with stress genesHeat shock experiments, expression analysis
    Novel enzymatic activityDistant homology to hydrolasesActivity screening with diverse substrates

The experimental validation of these computational predictions should follow the experimental design principles discussed in FAQ 2.2 to systematically test each hypothesis .

How can recombinant PH0672 be utilized in biotechnological applications?

While PH0672's function remains under investigation, proteins from hyperthermophiles like Pyrococcus horikoshii have significant biotechnological potential due to their extreme stability. Possible applications include:

  • Thermostable enzyme engineering:

    • Use as a scaffold for directed evolution experiments

    • Structure-guided design of chimeric enzymes with enhanced thermostability

    • Application in high-temperature industrial processes

  • Methodological approach for application development:

    PhaseMethodologyExpected Output
    Function determinationActivity screening, structural analysisIdentified biochemical activity
    Stability characterizationThermal shift assays, half-life studiesStability parameters
    Application designStructure-based engineeringModified protein for specific applications
    Process developmentScale-up, optimizationIndustrial-scale production protocol
  • Structural biology applications:

    • Use as a model system for studying protein thermostability

    • Application in crystallization chaperone technology

    • Development of thermostable fusion partners for difficult-to-express proteins

The complete realization of PH0672's biotechnological potential requires thorough functional characterization as outlined in previous sections .

What are the best approaches for designing experiments to study protein-protein interactions involving PH0672?

Investigating protein-protein interactions for a protein of unknown function requires a comprehensive experimental design strategy:

  • Randomized Block Design (RBD) for confirmation studies:

    • Group experimental conditions (temperature, pH, salt concentration) into blocks

    • Test interactions under each condition to identify environmental dependencies

    • Reduce experimental error by controlling for batch effects

  • Factorial design for studying interaction dependencies:

    FactorLevelsPurpose
    Temperature25°C, 50°C, 75°C, 95°CTest thermostability of interactions
    pH5.0, 6.0, 7.0, 8.0Identify pH dependence
    Salt concentration0.1M, 0.5M, 1.0MTest ionic strength effects
    CofactorsPresent/AbsentIdentify cofactor requirements

By combining these experimental design approaches with the interaction methods described in FAQ 2.5, researchers can systematically identify and characterize the interaction network of PH0672 .

How can researchers analyze and interpret contradictory data in PH0672 structural studies?

When studying novel proteins like PH0672, contradictions in structural data are common. A systematic approach to resolving these includes:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.