Recombinant Pyrococcus horikoshii UPF0252 protein PH1321 (PH1321)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PH1321; UPF0252 protein PH1321
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Target Names
PH1321
Target Protein Sequence
MQEYKELIKECAKELEGLMPEISQKLVNIAKINSPDRAFLEYLKVVEQVSLMKTERKQKN KALIILWRYGEALEKELYSDVKFFAKPLHKRIFRFVDWKIIGMLFLVFIILPAITSNLWS FRSEHYVLYLNENVDFPRELCNYRTSWLYDFRTSMVCVLKYGYGSINVTLRGNSWEKGVE AQRFISDMEYDFDRVKSPITYIQTPKETLRYKKGVCSDFALLVANILLDNNVSPVYIVHT VVRKEPSGGHAAAGIYVNGTLWILDWGSKPTKFQEYLENIDRIWEIREVRIYRITRDRIT LERIYKARLEDDRWRFLYSVIIMLGIFILKRREWWIM
Uniprot No.

Target Background

Database Links

KEGG: pho:PH1321

STRING: 70601.PH1321

Protein Families
UPF0252 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How is recombinant PH1321 typically expressed and purified for research purposes?

Recombinant PH1321 is typically expressed in E. coli expression systems. The methodology involves:

  • Amplification of the PH1321 gene from P. horikoshii genomic DNA using high-fidelity PCR systems

  • Cloning into a T7 RNA polymerase-based expression vector (such as pET16b) with appropriate fusion tags (commonly His-tag)

  • Transformation into E. coli expression strains (such as BL21(DE3))

  • IPTG induction (typically 0.4 mM) for protein expression

  • Purification via affinity chromatography using the fusion tag (for His-tagged proteins, Ni-agarose columns with imidazole elution)

The purified protein is typically stored in Tris-based buffer containing glycerol at -20°C to -80°C for extended storage . Researchers should avoid repeated freeze-thaw cycles as this can compromise protein integrity.

What are the optimal storage conditions for maintaining PH1321 stability?

For optimal stability of recombinant PH1321 protein:

Storage PurposeRecommended ConditionsBuffer CompositionNotes
Short-term use4°CTris/PBS-based buffer, pH 8.0Up to one week
Medium-term storage-20°CTris-based buffer with 50% glycerolAliquot to avoid freeze-thaw cycles
Long-term preservation-80°CTris-based buffer with 6% Trehalose, pH 8.0Recommended for extended storage

For reconstitution, it is recommended to centrifuge the vial briefly before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 5-50% is advised for long-term storage at -20°C or -80°C .

How should experiments be designed to effectively study thermostable proteins like PH1321?

When designing experiments with thermostable proteins like PH1321 from hyperthermophilic organisms, consider the following methodological approach:

  • Define your variables clearly: Identify independent variables (temperature, pH, substrate concentration) and dependent variables (enzyme activity, binding affinity)

  • Establish a temperature range: Include control points at both standard temperatures (25-37°C) and elevated temperatures (80-100°C) to capture the thermostability profile

  • Design experimental treatments:

    • Use a factorial design to test multiple factors simultaneously

    • Include temperature stress tests with gradually increasing temperatures

    • Test protein activity at various time points during high-temperature incubation

  • Randomization and replication: Ensure experimental validity through proper randomization of trials and sufficient replication (minimum triplicate measurements)

  • Specialized equipment considerations: Use thermostable reaction vessels and calibrated high-temperature water baths or thermal cyclers

This experimental design allows for systematic evaluation of thermostability properties while controlling for confounding variables that might affect protein performance .

What comparative analysis approaches are recommended when studying PH1321 in relation to other archaeal proteins?

For comparative analysis of PH1321 with other archaeal proteins, implement a systematic approach:

  • Sequence-based comparison:

    • Multiple sequence alignment (MSA) with homologous proteins from other archaeal species

    • Phylogenetic analysis to determine evolutionary relationships

    • Identification of conserved domains and motifs

  • Structural comparison:

    • Superimposition of crystal structures or predicted models

    • Root mean square deviation (RMSD) calculation for structural alignment

    • Analysis of thermostability-conferring structural elements

  • Functional comparison:

    • Component analysis: Test individual domains or regions separately

    • Parametric analysis: Systematically vary conditions to identify optimal functional parameters

    • Comparative analysis: Direct side-by-side testing of PH1321 against homologous proteins

  • Statistical analysis:

    • ANOVA or mixed effects models to assess significant differences

    • Post-hoc tests to identify specific group differences

    • Data visualization through heat maps or radar charts for multi-parameter comparisons

This methodological framework allows researchers to systematically identify unique properties of PH1321 compared to other archaeal proteins while controlling for experimental variability.

What techniques are most effective for assessing the function of PH1321 protein?

To effectively assess the function of PH1321 protein, researchers should employ a combination of biochemical and biophysical techniques:

  • Activity assays:

    • Develop specific activity assays based on predicted function

    • Test activity across temperature ranges (25°C to 100°C)

    • Monitor activity in real-time using fluorescence or absorbance-based methods

  • Binding studies:

    • Surface Plasmon Resonance (SPR) to measure binding kinetics

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

    • Fluorescence polarization for smaller molecule interactions

  • Structural characterization:

    • Circular Dichroism (CD) spectroscopy to assess secondary structure stability at different temperatures

    • Dynamic Light Scattering (DLS) to monitor aggregation states

    • Differential Scanning Calorimetry (DSC) to determine melting temperature (Tm)

  • Protein-protein interaction analysis:

    • Yeast two-hybrid assays as performed for other P. horikoshii proteins

    • Co-immunoprecipitation to validate interaction partners

    • Pull-down assays using tagged recombinant protein

These methodological approaches should be conducted under carefully controlled conditions, with appropriate positive and negative controls to ensure reliability of the functional assessment.

What are the recommended protocols for expressing PH1321 in E. coli to maximize yield and purity?

To optimize expression and purification of PH1321 in E. coli:

  • Strain selection:

    • Use E. coli Rosetta(DE3) or BL21(DE3) strains for high expression

    • Consider strains with additional rare codon tRNAs for archaeal protein expression

  • Expression vector optimization:

    • Clone PH1321 into pET16b or pET23a(+) vectors with N-terminal His-tag

    • Ensure the presence of a strong T7 promoter system

    • Optimize codon usage for E. coli expression

  • Culture conditions:

    • Grow bacterial culture at 37°C in Luria-Bertani medium containing appropriate antibiotics

    • Induce at OD600 of ~0.6 with 0.4 mM IPTG

    • Continue expression for 6 hours at 37°C with constant shaking

  • Purification strategy:

    • Harvest cells by centrifugation and store pellet at -80°C until processing

    • Resuspend in buffer containing 50 mM Tris-HCl (pH 7.5)

    • Use nickel affinity chromatography with imidazole gradient elution

    • Dialyze against storage buffer containing 50 mM Tris-HCl (pH 7.5), 0.2 M NaCl, 5 mM EDTA, 2 mM DTT, and 10% glycerol

Using this methodological approach, approximately 30 mg of purified PH1321 can be recovered from a 1-liter bacterial culture with greater than 90% purity as determined by SDS-PAGE .

How can researchers design experiments to determine if PH1321 forms part of a protein complex in P. horikoshii?

To investigate whether PH1321 participates in protein complexes within P. horikoshii, implement a multi-faceted experimental approach:

  • In vivo interaction studies:

    • Apply yeast two-hybrid system using PH1321 as bait against a P. horikoshii genomic library

    • Perform systematic screening against known P. horikoshii proteins similar to studies done with ribonuclease P subunits

  • Co-immunoprecipitation validation:

    • Generate specific antibodies against recombinant PH1321

    • Perform co-IP experiments using P. horikoshii cell extracts

    • Analyze precipitated proteins by mass spectrometry

  • Crosslinking studies:

    • Apply in vivo crosslinking in native P. horikoshii cultures

    • Use crosslinkers with varying spacer arm lengths to capture different spatial arrangements

    • Analyze crosslinked complexes by mass spectrometry following digestion

  • Native complex isolation:

    • Perform blue native PAGE analysis of P. horikoshii extracts

    • Conduct size exclusion chromatography to isolate native complexes

    • Use analytical ultracentrifugation to determine complex stoichiometry

For data analysis, implement a comparative approach contrasting results from each method to build a comprehensive interaction network model, similar to approaches used for other P. horikoshii proteins like those in ribonuclease P complexes .

What approaches should be used to investigate the potential enzymatic activity of PH1321 given its unknown function?

Given that PH1321 is a protein of unknown function, a systematic approach to investigate potential enzymatic activities includes:

  • Bioinformatic prediction:

    • Perform detailed sequence analysis against characterized enzyme families

    • Identify conserved motifs and potential catalytic residues

    • Use structural predictions to identify potential substrate-binding pockets

  • Substrate screening:

    • Design a parametric analysis with diverse substrate panels

    • Test activity across substrate classes (nucleotides, amino acids, carbohydrates, lipids)

    • Employ multiplexed assay formats to efficiently screen multiple conditions

  • Activity condition optimization:

    • Systematically vary buffer composition, pH, temperature, and cofactors

    • Implement full factorial experimental design to identify optimal conditions

    • Use response surface methodology to model enzyme behavior

  • Mechanism investigation:

    • Conduct site-directed mutagenesis of predicted catalytic residues

    • Perform isotope labeling studies to track atom transfers

    • Use enzyme kinetics to determine reaction mechanism

This methodological framework has proven successful in characterizing previously unknown archaeal enzymes, as demonstrated in studies of bifunctional enzymes from P. horikoshii .

What are the common challenges in working with hyperthermophilic proteins like PH1321 and how can they be addressed?

Researchers working with hyperthermophilic proteins like PH1321 commonly encounter several challenges that require specific methodological solutions:

  • Inconsistent activity measurements:

    • Problem: Standard activity assays may not be optimized for thermophilic conditions

    • Solution: Develop temperature-controlled assay platforms with pre-equilibration steps; use thermostable reagents and buffers; include internal standards for normalization

  • Protein aggregation during expression:

    • Problem: Hyperthermophilic proteins may misfold at mesophilic expression temperatures

    • Solution: Lower induction temperature to 18-25°C; co-express with chaperones; use solubility-enhancing fusion tags; consider cell-free expression systems

  • Improper folding in heterologous systems:

    • Problem: E. coli may lack specific factors needed for proper folding

    • Solution: Consider refolding protocols from inclusion bodies; explore expression in other hosts like yeast; implement denaturation-renaturation cycles with gradual temperature increases

  • Thermostability assessment challenges:

    • Problem: Conventional stability assays may be insufficient for hyperthermophilic proteins

    • Solution: Use differential scanning calorimetry with extended temperature ranges; implement thermal shift assays with specialized high-temperature fluorescent dyes; develop activity retention assays after prolonged high-temperature incubation

Each of these methodological approaches has been successfully applied to other P. horikoshii proteins and can be adapted to address specific challenges with PH1321.

How should researchers approach contradictory results when characterizing PH1321?

When confronted with contradictory results in PH1321 characterization studies, implement this systematic resolution framework:

  • Data validation and quality assessment:

    • Re-examine raw data and experimental controls for all contradictory results

    • Evaluate statistical power and significance through power analysis

    • Verify reagent quality and instrument calibration

  • Systematic variation analysis:

    • Design controlled experiments that explicitly test contradictory findings

    • Implement a full factorial design varying potential confounding variables

    • Use DOE (Design of Experiments) methodology to identify interaction effects

  • Method-dependent effects evaluation:

    • Compare results obtained through different methodological approaches

    • Consider if contradictions arise from method-specific artifacts

    • Develop orthogonal validation techniques for key findings

  • Collaborative verification:

    • Share materials with collaborating laboratories for independent verification

    • Standardize protocols across research groups

    • Implement blinded analysis to reduce confirmation bias

This structured approach helps distinguish between genuine biological complexity and experimental artifacts, particularly important when working with challenging proteins from extremophilic organisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.