Recombinant Pyrococcus kodakaraensis Molybdate/tungstate transport system permease protein wtpB (wtpB)

Shipped with Ice Packs
In Stock

Description

Overview of WtpB

WtpB is the permease subunit of the WtpABC transporter complex, a system evolutionarily conserved in archaea like Pyrococcus and Thermococcus species. This ATP-binding cassette (ABC) transporter operates with three subunits:

  • WtpA: Periplasmic substrate-binding protein (high affinity for WO₄²⁻ and MoO₄²⁻) .

  • WtpB: Permease component forming transmembrane channels for oxyanion translocation .

  • WtpC: ATPase providing energy for transport .

Recombinant WtpB is produced heterologously in Escherichia coli systems, enabling biochemical and structural studies .

Primary Structure

  • Domains: Predicted transmembrane helices typical of ABC permeases, facilitating ion channel formation .

Expression Systems

FeatureDetailsSource
HostE. coli
TagN-terminal His-tag
Purity≥85–90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose; stable at -80°C

Functional Role in Metal Transport

WtpB enables the uptake of Mo/W oxyanions through conformational changes driven by ATP hydrolysis from WtpC . Key functional insights include:

  • Substrate Specificity: Works with WtpA, which binds tungstate (K<sub>D</sub> = 17 pM) and molybdate (K<sub>D</sub> = 11 nM) .

  • Regulation: Expression of WtpABC is upregulated under low tungstate conditions, as observed in Pyrococcus furiosus .

  • Complex Assembly: WtpB forms a dimeric transmembrane channel, alternating between inward- and outward-facing states during transport .

Key Studies

  • Metal Incorporation: WtpA-Mo adducts were identified in P. furiosus membrane fractions under Mo-rich conditions, confirming WtpB’s role in retaining metal-bound complexes during transport .

  • Hyperthermophilic Adaptations: T. kodakaraensis expression platforms exploit WtpB’s thermostability for industrial enzyme production .

Comparative Analysis with Related Proteins

ProteinOrganismFunctionAffinity (K<sub>D</sub>)
ModBArchaeoglobus fulgidusMolybdate permease~100 nM (MoO₄²⁻)
TupBEubacterium acidaminophilumTungstate permease~50 nM (WO₄²⁻)
WtpBP. kodakaraensisDual Mo/W permeaseN/A (structural role)

Future Directions

  • Structural Studies: Cryo-EM or crystallography to resolve WtpB’s transmembrane architecture.

  • Biotechnological Use: Leverage thermostability for synthetic biology applications in extreme environments .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format we have in stock, you may specify your preferred format by leaving a remark during order placement. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
wtpB; TK0018; Molybdate/tungstate transport system permease protein WtpB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1))
Target Names
wtpB
Target Protein Sequence
MRRDYTLYLFAALGTFLIAYIAVPIAVIFLKQASDVEMLVKTLHDPYVIEAIRNSLLTAT ATALIALLFGVPLGYVLARKDFPGKSAVQALVDVPIVIPHSVVGIMLLVTFSNSILDSYK GIVAAMLFVSAPFTINAARDGFLAVDEKLEAVARTLGASRWRAFLSISLPMAFPSIASGA IMTWARAISEVGAILIVAYYPKTAQVLILEYFNNYGLRASRPIAVIMVSLSLGIFVILRW LVGRKNA
Uniprot No.

Target Background

Function
Recombinant Pyrococcus kodakaraensis Molybdate/tungstate transport system permease protein wtpB (wtpB) is a component of the ABC transporter complex WtpABC, involved in molybdate/tungstate import. It is likely responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: tko:TK0018

STRING: 69014.TK0018

Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular identity of wtpB from Pyrococcus kodakaraensis?

The wtpB protein from Pyrococcus kodakaraensis (strain ATCC BAA-918/JCM 12380/KOD1) is a membrane permease component of an ABC transport system specific for molybdate and tungstate ions. It is classified as a transmembrane protein containing multiple membrane-spanning domains that form the channel through which these metal oxoanions are transported. The protein is encoded by the wtpB gene (locus tag TK0018) in the P. kodakaraensis genome . This protein has a UniProt accession number of Q5JEB3 and functions as part of a multicomponent transport system that includes a substrate-binding protein and an ATPase component .

How does wtpB function within the ABC transporter system?

The wtpB protein functions as the transmembrane permease component of the ABC transport system. Based on comparative studies with similar systems, the complete transporter typically consists of:

  • A substrate-binding protein (SBP) that captures molybdate/tungstate ions from the environment with high specificity

  • The transmembrane permease (wtpB) that forms the channel through the membrane

  • An ATPase component that provides energy for transport through ATP hydrolysis

In this system, wtpB likely interacts directly with both the substrate-binding protein and the ATPase component. When the substrate-binding protein captures molybdate or tungstate, it undergoes a conformational change and docks with the permease component. This interaction triggers structural changes in wtpB that create a pathway for the substrate to cross the membrane .

How does wtpB compare structurally to other permease proteins in ABC transporters?

Based on comparative analysis with other ABC transporters, wtpB appears to belong to a specific structural family. Research on ABC transporters for molybdate and tungstate indicates two distinct structural types:

  • Type I ABC importers (like afModBC) - Typically contain 12 transmembrane α-helices

  • Type II ABC importers (like hiMolBC) - Contain approximately 20 transmembrane α-helices

The wtpB protein from P. kodakaraensis shows high sequence similarity (87%) with the permease component from the putative ABC transporters in Thermococcus kodakarensis KOD1, suggesting they share similar structural features . It's likely that wtpB belongs to one of these structural classes, though detailed structural characterization would be necessary to confirm its exact fold.

What is the substrate specificity of the wtpB-containing transport system?

The transport system containing wtpB shows specificity for both molybdate (MoO₄²⁻) and tungstate (WO₄²⁻) oxoanions. These chemically similar oxoanions are essential micronutrients required for the synthesis of molybdenum- and tungsten-containing enzymes that play crucial roles in archaeal metabolism.

Comparative studies of molybdate/tungstate transporters reveal significant variation in substrate affinities. For example:

Transport SystemSubstrateDissociation Constant (Kᴅ)Binding Characteristics
WtpA (P. furiosus)Tungstate17 ± 7 pMVery high affinity, exothermic binding
WtpA (P. furiosus)Molybdate11 ± 5 nMHigh affinity, endothermic binding
afModAMolybdate0.11 μMHigh affinity
hiMolAMolybdate50-100 μMLow affinity

The P. kodakaraensis system containing wtpB likely has similar binding characteristics to the related P. furiosus system, suggesting high affinity for both molybdate and tungstate, with a particular preference for tungstate .

How does the binding affinity affect transport kinetics in systems containing wtpB?

Research on different molybdate/tungstate transporters has revealed two distinct mechanisms:

  • High-affinity systems form stable, slow-dissociating complexes that are destabilized by nucleotide and substrate binding

  • Low-affinity systems form transient complexes that are stabilized by ligands

The P. kodakaraensis system containing wtpB likely functions as a high-affinity transport system based on its similarity to other archaeal transporters. In such systems, the rate-limiting step is often the release of substrate from the binding protein to the permease (wtpB) rather than the initial binding of substrate .

What expression systems are suitable for recombinant wtpB production?

Producing functional recombinant membrane proteins like wtpB presents significant challenges due to their hydrophobic nature and complex folding requirements. Based on experiences with similar archaeal membrane proteins, the following expression strategies can be considered:

  • E. coli-based expression systems:

    • BL21-CodonPlus-(DE3)-RIL cells have been successfully used for expressing archaeal proteins with rare codons

    • Expression vectors with carefully selected promoters (like pASK-IBA2) can provide controlled expression levels

    • Fusion tags such as Strep-tag can facilitate purification while minimally affecting protein function

  • Leader sequence optimization:

    • Native archaeal leader sequences often function poorly in E. coli

    • Replacing the native leader with an E. coli signal peptide (like OmpA) can improve membrane targeting

    • This approach yielded approximately 5 mg of functional protein per liter of culture for similar archaeal proteins

  • Expression conditions:

    • Induction at lower temperatures (20-25°C) can improve proper folding

    • Longer expression times with lower inducer concentrations may increase yield of functional protein

    • Specialized media formulations can enhance membrane protein production

What purification strategies are effective for recombinant wtpB?

Purification of membrane proteins requires specialized approaches to maintain their native conformation in detergent micelles. Based on successful purification of similar proteins, the following strategy is recommended:

  • Membrane isolation and solubilization:

    • Harvest cells and disrupt by mechanical methods (French press or sonication)

    • Isolate membrane fraction by differential centrifugation

    • Solubilize membranes using mild detergents (DDM, LDAO, or C₁₂E₈)

  • Affinity chromatography:

    • If expressed with a Strep-tag, use Strep-Tactin affinity chromatography

    • Carefully optimize detergent concentration in all buffers

    • Include stabilizing agents like glycerol (25-50%) in buffers

  • Size-exclusion chromatography:

    • Further purify protein by gel filtration in detergent-containing buffer

    • This step separates properly folded protein from aggregates

    • Use Tris-based buffers with optimized detergent concentrations

Storage recommendations include maintaining the protein in 50% glycerol at -20°C for short-term or -80°C for extended storage, avoiding repeated freeze-thaw cycles .

How does the P. kodakaraensis wtpB compare to similar proteins in other archaea?

The wtpB permease from P. kodakaraensis shows high sequence similarity (87%) with permease components from related archaeal species, particularly those within the Thermococcales order . This high degree of conservation suggests a similar functional role across these thermophilic archaea.

Comparative analysis between different molybdate/tungstate transporters reveals important evolutionary adaptations:

  • The tungstate transport protein system in P. furiosus (including WtpA, WtpB, and WtpC) represents a distinctive ABC transporter system that differs significantly from previously characterized ModA (molybdate) and TupA (tungstate) systems

  • This transport system appears to be widely distributed among archaea, suggesting its importance in metal homeostasis in these organisms

  • Despite the conservation of function (molybdate/tungstate transport), there is significant mechanistic divergence among ABC transporters, even when they share the same substrate specificity

These differences likely reflect adaptations to different environmental conditions and metabolic requirements across archaeal species.

What experimental approaches reveal differences between molybdate/tungstate transport systems?

Research has identified significant mechanistic divergence among ABC transporters with identical substrate specificity. Key experimental approaches to study these differences include:

  • Isothermal Titration Calorimetry (ITC):

    • Directly measures binding thermodynamics (Kᴅ, ΔH, ΔS)

    • Reveals differences in binding stoichiometry and energetics

    • Can distinguish between endothermic (molybdate) and exothermic (tungstate) binding interactions

  • Displacement titration experiments:

    • Assess competitive binding between molybdate and tungstate

    • Demonstrate preference for one substrate over another

    • Reveal the order of binding preference (tungstate typically displaces molybdate)

  • Structural fold analysis:

    • Comparison of transmembrane domain structures reveals distinct types (I and II)

    • Type I importers typically contain 12 transmembrane α-helices

    • Type II importers contain approximately 20 transmembrane α-helices

These approaches have revealed that transporters like afModBC form high-affinity, slow-dissociating complexes that are destabilized by nucleotide and substrate binding, while others like hiMolBC form low-affinity, transient complexes that are stabilized by ligands .

How can site-directed mutagenesis elucidate wtpB function?

Site-directed mutagenesis represents a powerful approach to investigate structure-function relationships in wtpB. Based on the amino acid sequence provided , several targeted mutagenesis strategies could yield valuable insights:

  • Transmembrane domain modifications:

    • Mutating conserved residues within predicted transmembrane helices (e.g., GVPLGYVLARK) to assess their role in channel formation

    • Introducing charged residues into hydrophobic domains to disrupt membrane spanning

    • Creating chimeric proteins with domains from related permeases to identify functional regions

  • Interface residue alterations:

    • Modifying residues likely involved in interactions with the substrate-binding protein

    • Mutating potential ATPase-interaction domains to disrupt energy coupling

    • Changing conserved residues at predicted subunit interfaces

  • Substrate pathway identification:

    • Conducting cysteine-scanning mutagenesis along predicted channel-forming regions

    • Using accessibility studies with thiol-reactive compounds to map the substrate translocation pathway

    • Introducing reporter groups at strategic positions to monitor conformational changes during transport

For each mutant, functional assays measuring transport activity can be correlated with structural changes to build a comprehensive model of wtpB function.

What advanced analytical techniques are most informative for studying wtpB structure and mechanism?

Understanding the structure and mechanism of wtpB requires sophisticated analytical approaches:

  • Structural determination methods:

    • X-ray crystallography of the isolated permease or complete transporter

    • Cryo-electron microscopy to visualize different conformational states

    • NMR spectroscopy of specific domains or the complete protein in detergent micelles

  • Functional analysis techniques:

    • Reconstitution into proteoliposomes for transport assays

    • Substrate flux measurements using radioisotopes or fluorescent analogs

    • ATPase activity coupling assays to correlate ATP hydrolysis with transport

  • Protein-protein interaction studies:

    • Surface plasmon resonance to measure binding kinetics with other transporter components

    • Förster resonance energy transfer (FRET) to monitor dynamic interactions

    • Cross-linking studies to capture transient interaction states

  • Computational approaches:

    • Molecular dynamics simulations of membrane insertion and channel formation

    • Homology modeling based on related transporters with known structures

    • Substrate docking simulations to identify potential binding sites

Combining these approaches can provide a comprehensive understanding of how wtpB functions within the complete transport system and how it achieves selectivity for molybdate and tungstate ions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.