Recombinant Pyrococcus kodakaraensis Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Definition and Context

The recombinant Pyrococcus kodakaraensis Protease HtpX homolog (htpX) is a bioengineered version of the native HtpX protease from the thermophilic archaeon Pyrococcus kodakaraensis. HtpX homologs are widely distributed across archaea and bacteria, functioning as zinc-dependent metalloproteases involved in protein quality control and membrane-associated proteolysis . This recombinant variant is typically expressed in E. coli with an N-terminal His-tag for purification and functional studies .

Amino Acid Sequence and Expression

The recombinant protein spans residues 1-290 of the native HtpX, with the following key features:

  • GenBank Identifier: Q5JEZ8 (UniProt)

  • Gene Locus: TK0677 (chromosomal locus in P. kodakaraensis)

  • Sequence Highlights:

    MGLVMWLRTGVLMAILTGLLMGIGYLFGGPNVAFIMFLFSMFFNFITYWYSDRIVLSWYN ARIVDEYEAPELYAIVRDLAQRAGLPTPRVAIIPSETPNAFATGRDPKHAVVAVTQGLLR ILNRDELEGVIGHELTHIKNRDILIGTVAAAMAGAIMQLAYWARWIAIFGGFNRDRDDGG DIIGAILVAILAPIAAmLIQAAISRSREFLADEGGARISGKPHALASALMKIEQAVNYRP MREGNPATAHMFIVNPFRGMSIANLFSTHPPTEARIERLRKIAEEMGIYF

Biochemical Properties

PropertyValue/DescriptionSource
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Storage BufferTris-based buffer, 50% glycerol, pH 8.0
Zinc DependencyRequires Zn²⁺ for catalytic activity (self-cleavage and substrate degradation)
Proteolytic ActivityCleaves soluble proteins (e.g., casein) and membrane proteins (e.g., SecY)

Genomic and Evolutionary Context

HtpX homologs are classified under COG0501 (membrane-associated metal-dependent proteases) and MEROPS Family M48B (zinc-dependent metalloproteases) . In archaea, HtpX is part of a broader proteolytic network that includes 20S proteasomes and Lon proteases .

Distribution Across Archaeal Groups

Archaeal GroupHtpX PresenceNotesSource
TACKYesIncludes Thermococcus (e.g., P. kodakaraensis) and Korarchaeota
EuryarchaeotaYesFound in Haloarchaea (e.g., Halobacterium) and Methanogens
AsgardLimitedRestricted to a subset of Asgard archaea

Functional Studies

  • Protein Quality Control: HtpX participates in membrane protein degradation, particularly under stress conditions. In E. coli, it collaborates with FtsH (an ATP-dependent protease) to regulate SecY, a core component of the translocon .

  • Self-Degradation: HtpX undergoes zinc-dependent self-cleavage, a property critical for its regulation .

Industrial and Diagnostic Uses

  • ELISA Kits: Recombinant HtpX is used in immunoassays to detect antibodies or study archaeal proteases .

  • Thermostability: Its thermostable nature (derived from P. kodakaraensis) makes it suitable for high-temperature industrial processes .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes if needed. We will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify this in your order; we will prioritize your request during development.
Synonyms
htpX; TK0677; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1))
Target Names
htpX
Target Protein Sequence
MGLVMWLRTGVLMAILTGLLMGIGYLFGGPNVAFIMFLFSMFFNFITYWYSDRIVLSWYN ARIVDEYEAPELYAIVRDLAQRAGLPTPRVAIIPSETPNAFATGRDPKHAVVAVTQGLLR ILNRDELEGVIGHELTHIKNRDILIGTVAAAMAGAIMQLAYWARWIAIFGGFNRDRDDGG DIIGAILVAILAPIAAMLIQAAISRSREFLADEGGARISGKPHALASALMKIEQAVNYRP MREGNPATAHMFIVNPFRGMSIANLFSTHPPTEARIERLRKIAEEMGIYF
Uniprot No.

Target Background

Database Links

KEGG: tko:TK0677

STRING: 69014.TK0677

Protein Families
Peptidase M48B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Pyrococcus kodakaraensis Protease HtpX homolog and what are its basic structural features?

Pyrococcus kodakaraensis Protease HtpX homolog (htpX) is a zinc-dependent metalloprotease from the hyperthermophilic archaeon Pyrococcus kodakaraensis (strain ATCC BAA-918/JCM 12380/KOD1), also referred to as Thermococcus kodakaraensis (strain KOD1). The protein consists of 290 amino acids in its expression region and is identified by the UniProt accession number Q5JEZ8 and ordered locus name TK0677 . The protein contains a conserved zinc metalloprotease active site motif (HEXXH), which is characteristic of the peptidase M48 family, similar to the E. coli HtpX that functions in membrane protein quality control .

The protein sequence reveals a membrane-associated topology with multiple transmembrane regions evident in its N-terminal sequence, suggesting it is anchored to the membrane with its catalytic domain likely exposed to one side of the membrane. Like other proteases in the M48 family, it likely functions in protein quality control processes, particularly in stress response mechanisms that maintain membrane protein integrity under extreme conditions .

How does the molecular structure of htpX contribute to its thermostability?

The thermostability of Pyrococcus kodakaraensis Protease HtpX homolog stems from several structural adaptations common to proteins from hyperthermophilic organisms. Analysis of the amino acid sequence reveals several key features that contribute to its thermostability:

  • Increased hydrophobic core packing: The sequence contains clusters of hydrophobic residues that form a tightly packed core, stabilizing the protein at high temperatures.

  • Higher proportion of charged amino acids: The sequence shows an abundance of charged residues that can form extensive ionic networks (salt bridges) which provide stability at elevated temperatures.

  • Reduced number of thermolabile residues: The protein exhibits fewer asparagine and glutamine residues which are prone to deamidation at high temperatures.

  • Increased proline content in loop regions: These contribute to conformational rigidity.

Comparative analysis with mesophilic homologs would show these adaptations more clearly. Experimental approaches to verify these structural features would include circular dichroism spectroscopy at various temperatures, differential scanning calorimetry to determine melting temperatures, and limited proteolysis experiments at increasing temperatures to assess conformational stability .

What optimal buffer conditions should be used for storing and handling recombinant htpX?

For optimal stability and activity retention of recombinant Pyrococcus kodakaraensis Protease HtpX homolog, the following storage and handling conditions are recommended based on experimental data:

  • Storage buffer composition: Tris-based buffer supplemented with 50% glycerol, specifically optimized for this protein. The high glycerol concentration prevents freezing damage and stabilizes protein conformation .

  • Storage temperature: Store at -20°C for routine use. For extended storage periods, conserve at -20°C or -80°C to minimize degradation and activity loss .

  • Working aliquots: Prepare small working aliquots and store at 4°C for up to one week to avoid repeated freeze-thaw cycles, which can significantly reduce enzymatic activity .

  • Buffer pH considerations: Given its archaeal origin, consider testing buffers in the pH range of 6.0-8.0, with potential optimal activity at slightly acidic conditions that might mimic the native environment.

  • Metal ion supplementation: As a metalloprotease, consider adding zinc ions (typically 10-100 μM ZnCl₂) to assay buffers to ensure maximum catalytic activity, particularly if chelating agents have been used during purification.

Researchers should validate these conditions for their specific experimental applications, particularly when conducting activity assays at elevated temperatures characteristic of the enzyme's natural environment.

What expression systems are most effective for producing active recombinant htpX?

The optimal expression of functionally active Pyrococcus kodakaraensis Protease HtpX homolog presents several challenges due to its hyperthermophilic origin and membrane-associated nature. Based on successful approaches with similar archaeal proteins, the following expression strategies are recommended:

Table 1: Comparison of Expression Systems for Recombinant htpX Production

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli BL21(DE3)- High yield
- Established protocols
- Cost-effective
- Potential misfolding
- Inclusion body formation
- Lack of post-translational modifications
- Co-expression with chaperones (GroEL/ES)
- Low temperature induction (15-20°C)
- Use of solubility tags (SUMO, MBP)
E. coli C41/C43- Specialized for membrane proteins
- Reduced toxicity
- Lower yield than BL21
- May require optimization
- Optimize induction conditions
- Supplement with rare codons
- Use T7 Express system
Yeast systems
(P. pastoris)
- Better folding of eukaryotic-like domains
- Secretion capability
- Longer expression time
- More complex media
- Optimize methanol induction
- Use strong promoters (AOX1)
Cell-free systems- Rapid production
- Direct membrane incorporation
- Avoids toxicity issues
- Higher cost
- Lower scalability
- Technical complexity
- Supplement with lipid nanodiscs
- Optimize redox conditions

For purification, a two-step approach is recommended: initial immobilized metal affinity chromatography (IMAC) using the protein's His-tag, followed by size exclusion chromatography. The addition of mild detergents (0.03-0.1% DDM or LDAO) in all buffers is crucial to maintain membrane protein solubility. The expression strategy used for Pk-FtsZ, where it was successfully overexpressed in E. coli and purified in an active form, could serve as a useful template .

What assays are appropriate for measuring the proteolytic activity of htpX?

Measuring the proteolytic activity of Pyrococcus kodakaraensis Protease HtpX homolog requires specialized assays that account for its thermophilic nature and substrate specificity. The following methodological approaches are recommended:

  • Fluorogenic peptide substrates: Using peptides labeled with fluorescence resonance energy transfer (FRET) pairs that increase fluorescence upon cleavage. For M48 family metalloproteases, peptides containing hydrophobic residues at the P1 position are typically preferred. Assays should be conducted at elevated temperatures (60-90°C) to match the enzyme's physiological conditions .

  • Model protein substrates: α-casein has been successfully used as a substrate for similar metalloproteases like BepA (YfgC). The cleavage products can be analyzed by SDS-PAGE followed by Coomassie staining or silver staining for higher sensitivity. N-terminal sequencing of the cleavage products can confirm specific proteolytic activity, as demonstrated for BepA's cleavage of α-casein between F23 and F24 .

  • Membrane protein substrates: Given htpX's likely role in membrane protein quality control, testing its activity against denatured membrane proteins from P. kodakaraensis or thermostable model membrane proteins would provide physiologically relevant insights.

  • Inhibitor profiling: Testing the sensitivity to metalloprotease inhibitors such as 1,10-phenanthroline and EDTA can confirm the metalloprotease nature of the enzyme, as shown for BepA .

  • Temperature and pH profiling: Activity assays should be performed across a range of temperatures (40-100°C) and pH values (5.0-9.0) to determine optimal conditions, similar to the approach used for characterizing Pk-FtsZ's GTPase activity, which showed optimal activity above 80°C and minimal activity at 40°C .

How can site-directed mutagenesis be applied to study the catalytic mechanism of htpX?

Site-directed mutagenesis represents a powerful approach to elucidate the catalytic mechanism and structure-function relationships in Pyrococcus kodakaraensis Protease HtpX homolog. Based on insights from related metalloproteases, the following mutagenesis strategy is recommended:

  • Target residues in the catalytic motif: The conserved H-E-X-X-H motif contains two histidine residues that coordinate the zinc ion and a glutamate residue that functions as a catalytic base. Mutation of these residues to alanine or glutamine (for histidine) and glutamine (for glutamate) would help confirm their roles. Similar mutations in BepA (E137Q) abolished its proteolytic activity against α-casein .

  • Substrate-binding pocket residues: Identify hydrophobic and charged residues in proximity to the active site that may interact with substrates. Conservative mutations (e.g., Leu to Ile, Asp to Glu) can reveal the importance of specific chemical properties.

  • Thermostability-conferring residues: Target residues unique to thermophilic variants of HtpX for mutation to their mesophilic counterparts to assess contributions to thermostability.

  • Mutagenesis protocol optimization: For a thermophilic protein, consider using high-fidelity polymerases with enhanced thermostability (e.g., Phusion or Q5). The QuikChange method with some modifications for GC-rich templates is recommended.

  • Functional characterization of mutants: Compare wild-type and mutant proteins using:

    • Thermal stability assays (differential scanning calorimetry, thermal shift assays)

    • Proteolytic activity at various temperatures

    • Substrate specificity profiles

    • Metal binding capacity using isothermal titration calorimetry

For analyzing results, the E137Q mutation in BepA provides a valuable reference, as this mutation in the metalloprotease active site eliminated proteolytic activity while preserving substrate binding capacity .

How does Pyrococcus kodakaraensis htpX function differ from mesophilic homologs?

The functional differences between Pyrococcus kodakaraensis Protease HtpX homolog and its mesophilic counterparts stem from evolutionary adaptations to extreme environments. These differences manifest in several key aspects:

  • Thermodynamic properties: P. kodakaraensis htpX likely exhibits significantly higher thermal stability compared to mesophilic homologs, with optimal activity at temperatures above 80°C, similar to other enzymes from this organism. Mesophilic homologs typically show maximum activity at 30-40°C and rapid inactivation above 50°C. The thermostability difference can be quantified using differential scanning calorimetry to determine the melting temperature (Tm) .

  • Kinetic parameters: Thermophilic enzymes often exhibit lower catalytic efficiency (kcat/Km) at moderate temperatures compared to mesophilic counterparts but maintain activity at elevated temperatures where mesophilic enzymes denature. This pattern was observed with Pk-FtsZ, which showed minimal GTPase activity at 40°C but optimal activity above 80°C .

  • Structural rigidity vs. flexibility: P. kodakaraensis htpX likely possesses greater conformational rigidity at mesophilic temperatures, becoming appropriately flexible for catalysis only at elevated temperatures. This characteristic can be investigated using hydrogen-deuterium exchange mass spectrometry at various temperatures.

  • Substrate specificity: While the core function in protein quality control is likely conserved, the archaeal htpX may recognize distinct structural features in archaeal membrane proteins, potentially with broader substrate tolerance at high temperatures.

  • Interaction partners: The archaeal protein quality control system differs from bacterial systems, suggesting that P. kodakaraensis htpX may interact with a distinct set of partners. For instance, the archaeal stress response system shows differences in gene organization and regulation compared to bacterial systems, despite some conservation in gene order .

Experimental comparison would ideally involve parallel characterization of P. kodakaraensis htpX alongside its E. coli homolog across a range of temperatures, examining both thermostability and proteolytic function.

What is known about the substrate specificity of htpX and related archaeal proteases?

The substrate specificity of Pyrococcus kodakaraensis Protease HtpX homolog remains incompletely characterized, but insights can be derived from related proteases and bioinformatic analysis:

Based on homology to bacterial HtpX and other M48 family metalloproteases, P. kodakaraensis htpX likely targets membrane proteins that are misfolded or damaged, particularly under stress conditions. In E. coli, HtpX collaborates with the AAA+ protease FtsH to eliminate misfolded inner membrane proteins, suggesting a similar quality control function for the archaeal homolog .

The E. coli BepA protein (YfgC), another M48 family metalloprotease, demonstrates dual functionality by promoting either assembly or degradation of outer membrane proteins like LptD based on their folding state. BepA shows proteolytic activity against model substrates like α-casein, specifically cleaving between F23 and F24 . The archaeal htpX might show similar cleavage site preferences.

Substrate recognition likely involves:

  • Exposed hydrophobic patches characteristic of misfolded membrane proteins

  • Specific sequence motifs, potentially enriched in hydrophobic residues

  • Structural elements that become accessible only under thermal stress

To experimentally determine substrate specificity, researchers could:

  • Perform proteome-wide analysis of potential substrates using techniques like SILAC (Stable Isotope Labeling with Amino acids in Cell culture) comparing wild-type and htpX-deficient P. kodakaraensis strains

  • Test activity against synthetic peptide libraries to establish a consensus cleavage site

  • Examine interaction with and processing of known substrates of homologous proteases from other organisms

  • Use chimeric proteins where domains from mesophilic substrates are grafted onto thermostable scaffolds to identify recognition elements

The thermophilic nature of P. kodakaraensis may influence substrate specificity, potentially allowing the protease to recognize a broader range of structural abnormalities that emerge at elevated temperatures.

What crystallization strategies can be employed for structural studies of htpX?

Determining the three-dimensional structure of Pyrococcus kodakaraensis Protease HtpX homolog presents challenges due to its membrane-associated nature and thermophilic origin. Based on successful approaches with other archaeal proteins, the following crystallization strategies are recommended:

  • Protein preparation optimization:

    • Remove flexible or disordered regions that may hinder crystallization through limited proteolysis followed by mass spectrometry analysis

    • Consider using only the catalytic domain if full-length protein proves recalcitrant to crystallization

    • Ensure high purity (>95% by SDS-PAGE) and monodispersity (by dynamic light scattering)

    • Add zinc or other divalent metal ions to stabilize the active site

  • Membrane protein-specific approaches:

    • Detergent screening: Test a panel of detergents (DDM, LDAO, OG, CYMAL) for optimal solubilization while maintaining native structure

    • Lipidic cubic phase (LCP) crystallization: Particularly suitable for membrane proteins

    • Crystallization in lipid nanodiscs to maintain a more native-like environment

    • Consider fusion with crystallization chaperones (T4 lysozyme, BRIL) to increase soluble surface area

  • Thermostability exploitation:

    • Perform crystallization trials at elevated temperatures (30-45°C) to mimic native conditions while avoiding precipitation

    • Include stabilizing agents like glycerol or specific ions found in hyperthermophilic environments

  • Crystallization conditions:

    • Based on successful crystallization of Pk-REC from the same organism, try polyethylene glycol (PEG) precipitants:

      • PEG 3000 at pH 8.0 (resulted in orthorhombic crystal form I)

      • PEG 550 monomethylether at pH 8.0 (resulted in orthorhombic crystal form II)

    • Use hanging-drop vapor-diffusion method with various drop ratios

    • Screen with additives that promote crystal contacts, such as divalent cations or small molecules that bind to the active site

  • Alternative structural approaches:

    • Cryo-electron microscopy (cryo-EM) for membrane proteins recalcitrant to crystallization

    • Nuclear magnetic resonance (NMR) for individual domains if the full-length protein is too large

    • Small-angle X-ray scattering (SAXS) to obtain low-resolution envelopes and domain arrangements

The crystallization conditions should be systematically screened using commercially available sparse matrix screens, with particular attention to conditions that have worked for other thermophilic archaeal proteins .

How can protein-protein interaction studies reveal the functional networks of htpX?

Investigating the protein-protein interaction network of Pyrococcus kodakaraensis Protease HtpX homolog provides crucial insights into its cellular functions and regulatory mechanisms. Several complementary approaches can be employed to map these interactions:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged htpX (His-tag or FLAG-tag) in P. kodakaraensis or a heterologous thermophilic host

    • Perform crosslinking at elevated temperatures (60-80°C) to capture transient interactions

    • Use specialized detergents for membrane protein complexes (digitonin or amphipol)

    • Conduct stringent controls including non-specific binding to affinity resins

    • Analyze resulting protein complexes by high-resolution mass spectrometry

  • Bacterial/archaeal two-hybrid systems adapted for thermophiles:

    • Modify existing two-hybrid systems for high-temperature compatibility

    • Create a P. kodakaraensis genomic library to screen for interaction partners

    • Focus on thermostable reporter systems that function at elevated temperatures

  • Proximity-dependent biotin identification (BioID):

    • Fuse htpX to a thermostable biotin ligase

    • Identify proteins that become biotinylated due to proximity to htpX

    • This approach captures both stable and transient interactions

  • Co-evolution analysis:

    • Perform bioinformatic analysis of co-evolving gene pairs across archaeal genomes

    • Identify proteins that show coordinated evolutionary patterns with htpX

Based on knowledge of bacterial HtpX, potential interaction partners may include:

  • FtsH-like AAA+ proteases that cooperate in protein quality control

  • Membrane protein assembly factors

  • Stress response proteins

  • Substrate membrane proteins undergoing quality control

By analogy with BepA (YfgC), which interacts with the BAM complex in E. coli, the archaeal htpX may interact with archaeal membrane protein assembly machinery. BepA also showed interaction with and contributed to proper localization of LoiP (YggG), suggesting similar partnering between proteases in archaeal systems might occur .

How might evolutionary analysis of htpX inform our understanding of archaeal stress response?

  • Phylogenetic distribution and conservation:

    • Comprehensive sequence analysis reveals htpX homologs across archaeal phyla, with highest conservation in hyperthermophiles

    • Conservation patterns of the catalytic domain versus regulatory regions can distinguish core functional elements from lineage-specific adaptations

    • The gene order surrounding htpX may reveal conserved operons or genomic contexts related to stress response functions

  • Adaptive evolution signatures:

    • Analysis of selective pressure using dN/dS ratios across sites can identify residues under positive selection

    • Comparison between thermophilic and mesophilic lineages highlights adaptations specific to extreme temperature environments

    • Correlation between amino acid composition shifts and optimal growth temperature across species

  • Horizontal gene transfer assessment:

    • Identification of potential horizontal gene transfer events between archaea and bacteria for htpX

    • Determination of whether the archaeal htpX represents an ancestral form or a derived adaptation

  • Functional diversification:

    • Analysis of gene duplication events and subsequent functional specialization

    • Comparison with other stress-responsive proteases in archaeal genomes to map functional redundancy and specialization

The research on archaeal stress genes indicates that, despite similarities in gene organization between archaeal and bacterial stress response loci (like the hsp70 locus), their regulatory mechanisms appear fundamentally different . Similar distinctions may exist for htpX-related stress response systems. Unlike bacteria, archaea lack identifiable bacterial-type regulatory elements such as CIRCE or ROSE sequences in the promoter regions of stress genes .

This evolutionary perspective provides testable hypotheses about htpX function in the archaeal stress response network and insights into how protease-mediated quality control mechanisms have adapted to extreme conditions.

What potential biotechnological applications exist for thermostable proteases like htpX?

The thermostable nature and specialized proteolytic activity of Pyrococcus kodakaraensis Protease HtpX homolog present numerous opportunities for biotechnological applications across various industries. These applications leverage the enzyme's exceptional stability and potential activity under extreme conditions:

  • Biocatalysis and green chemistry:

    • Development of high-temperature proteolytic processes that reduce microbial contamination risks

    • Integration into multi-enzymatic cascades for complex biomass conversion

    • Creation of thermostable biocatalysts for peptide synthesis through reverse proteolysis

    • Application in continuous flow reactors where thermostability extends catalyst lifespan

  • Protein engineering platforms:

    • Use as a scaffold for directed evolution of novel proteolytic activities

    • Development of chimeric enzymes combining the thermostable framework with altered specificity domains

    • Creation of self-cleaving affinity tags for high-temperature protein purification

    • Design of thermo-responsive molecular switches based on controlled proteolysis

  • Analytical and research tools:

    • Development of thermostable proteases for proteomic sample preparation

    • Creation of reagents for high-temperature DNA/RNA isolation from thermophilic organisms

    • Use in structural biology to perform controlled proteolysis for crystallization

    • Application in hydrogen-deuterium exchange mass spectrometry at elevated temperatures

  • Industrial applications:

    • Integration into high-temperature bioprocessing workflows in biofuel production

    • Development of heat-tolerant detergent enzymes for industrial cleaning applications

    • Creation of biocatalysts for food processing that can operate during pasteurization

    • Application in waste treatment processes at elevated temperatures

  • Biopharmaceutical applications:

    • Development of thermostable enzymes for controlled degradation of protein aggregates

    • Creation of heat-activated prodrug conversion systems

    • Design of thermostable protease therapies for specific medical applications

The success of these applications would depend on thorough characterization of the enzyme's stability, specificity, and activity profiles across different conditions. The specific membrane protein quality control function of htpX could be particularly valuable for applications requiring selective proteolysis rather than broad degradation capacity .

How might CRISPR-based genome editing advance functional studies of htpX in Pyrococcus kodakaraensis?

CRISPR-Cas genome editing systems adapted for extremophiles offer unprecedented opportunities to investigate the in vivo function of Pyrococcus kodakaraensis Protease HtpX homolog through precise genetic manipulation. This approach would address the current limitations in understanding htpX's physiological role in its native thermophilic environment:

  • Development of thermostable CRISPR-Cas systems:

    • Identification and characterization of Cas9 or Cas12 variants from thermophilic organisms

    • Engineering existing CRISPR systems for enhanced thermostability through directed evolution

    • Optimization of guide RNA stability at elevated temperatures using chemical modifications or structured RNA designs

  • Gene knockout and complementation studies:

    • Creation of clean htpX deletion mutants in P. kodakaraensis

    • Phenotypic characterization under various stress conditions (heat shock, oxidative stress, protein misfolding agents)

    • Complementation with wild-type and catalytically inactive mutants to distinguish enzymatic and structural functions

    • Synthetic lethality screening to identify genetic interactions with other quality control components

  • Domain function analysis:

    • Generation of truncation variants to assess the role of transmembrane versus catalytic domains

    • Creation of chimeric proteins with domains from mesophilic homologs to identify thermostability determinants

    • Introduction of point mutations at conserved residues to probe structure-function relationships in vivo

  • Regulated expression systems:

    • Development of inducible promoters functional in P. kodakaraensis

    • Creation of depletion strains to study essential functions

    • Establishment of tunable expression systems to determine dosage effects

  • Reporter systems for monitoring htpX activity:

    • Integration of proteolytic sensors that produce measurable signals upon cleavage

    • Development of stress response reporters to monitor the cellular conditions triggering htpX activity

    • Creation of tagged substrates for in vivo tracking of htpX-mediated degradation

This CRISPR-based approach would bridge the current gap between biochemical characterization and physiological function, providing definitive evidence for htpX's role in protein quality control under extreme conditions. The technology would also establish a platform for broad functional genomics in thermophilic archaea, advancing our understanding of adaptations to extreme environments .

What structural biology approaches beyond crystallography could reveal htpX conformational dynamics?

Understanding the conformational dynamics of Pyrococcus kodakaraensis Protease HtpX homolog is crucial for elucidating its catalytic mechanism and substrate recognition. Several cutting-edge structural biology approaches beyond traditional X-ray crystallography can provide complementary insights:

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for high-resolution structure determination without crystallization

    • Visualization of different conformational states in a heterogeneous sample

    • Capture of substrate-bound states through time-resolved cryo-EM

    • Advantage: Can visualize membrane-embedded portions of htpX in near-native lipid environments using nanodiscs or amphipols

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Mapping protein dynamics and solvent accessibility at peptide-level resolution

    • Identification of conformational changes upon substrate binding or temperature shifts

    • Analysis of regional thermostability differences within the protein structure

    • Advantage: Compatible with membrane proteins and functions at elevated temperatures

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Solution-state NMR for dynamic regions and smaller domains

    • Solid-state NMR for membrane-embedded portions

    • Real-time monitoring of conformational changes and catalytic steps

    • Advantage: Provides atomic-level information about dynamics and interactions in solution

  • Small-angle X-ray/neutron scattering (SAXS/SANS):

    • Low-resolution structural envelopes of htpX in different functional states

    • Contrast matching with deuterated components to focus on specific domains

    • Analysis of temperature-dependent conformational ensembles

    • Advantage: Minimal sample preparation and compatible with solution conditions

  • Integrative structural biology approaches:

    • Combination of multiple experimental data sources with computational modeling

    • Molecular dynamics simulations at elevated temperatures to capture thermophilic behavior

    • Cross-linking mass spectrometry to identify domain arrangements and protein-protein interfaces

    • Advantage: Provides a comprehensive view by leveraging strengths of individual techniques

The integration of these approaches would provide multi-scale structural information from atomic details to global architecture, capturing both static features and dynamic behaviors. This comprehensive structural characterization would significantly advance our understanding of how htpX's structure enables its function in extreme environments and how it differs from mesophilic homologs like E. coli HtpX and BepA .

How can systems biology approaches integrate htpX function into broader archaeal stress response networks?

Systems biology approaches offer powerful frameworks to position Pyrococcus kodakaraensis Protease HtpX homolog within the broader context of archaeal stress response networks, revealing its integrated functions and regulatory connections. These methodologies can generate testable models that bridge molecular mechanisms with cellular phenotypes:

  • Multi-omics integration:

    • Comparative transcriptomics of wild-type versus htpX-deficient strains under various stress conditions

    • Proteomics to identify accumulating substrates in htpX mutants

    • Metabolomics to detect downstream effects of protein quality control defects

    • Integration of these datasets to construct comprehensive stress response models

  • Network analysis and modeling:

    • Construction of protein-protein interaction networks centered on htpX

    • Mapping genetic interactions through synthetic genetic array analysis adapted for thermophiles

    • Bayesian network inference to identify causal relationships in stress response pathways

    • Flux balance analysis to model the impact of protein quality control on cellular energetics

  • Comparative systems biology:

    • Cross-species comparison of stress response networks between P. kodakaraensis and other archaea

    • Evolutionary analysis of network architecture between thermophilic and mesophilic organisms

    • Identification of network motifs conserved across domains of life versus archaeal-specific features

  • Single-cell approaches:

    • Development of single-cell analysis methods for thermophilic archaea

    • Characterization of cell-to-cell variability in stress responses

    • Monitoring of protein aggregation and quality control in individual cells

  • Computational modeling:

    • Agent-based models of protein quality control incorporating htpX function

    • Prediction of system-level consequences of htpX perturbation

    • Integration of structural information with cellular-scale models

Unlike bacteria, archaea appear to employ distinct regulatory mechanisms for stress genes despite some similarities in gene organization. The archaeal stress gene loci lack bacterial-type regulatory elements such as CIRCE or ROSE sequences, suggesting fundamentally different stress response regulation . The P. kodakaraensis htpX likely participates in these archaeal-specific networks, potentially interfacing with other quality control systems adapted to extreme conditions.

Systems biology approaches would reveal how htpX cooperates with other proteases, chaperones, and regulatory factors to maintain proteostasis under stress conditions, providing a comprehensive understanding of archaeal adaptation to extreme environments that could inform both fundamental biology and biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.