Recombinant Pyrophosphate-energized proton pump 1 (hppA1)

Shipped with Ice Packs
In Stock

Description

Functional Mechanism

hppA1 hydrolyzes PPi into inorganic phosphate (Pi), coupling this exothermic reaction to proton translocation across membranes. This generates a proton gradient (ΔμH+), which drives ATP synthesis or nutrient transport . Key functional insights include:

  • Energy Conservation: In Rhodospirillum rubrum, hppA1 compensates for ATP scarcity by utilizing PPi—a byproduct of biosynthesis—to maintain cellular energetics .

  • Malaria Parasites: Plasmodium falciparum employs its ortholog, PfVP1, as the primary proton pump during the metabolically quiescent ring stage, enabling survival under low ATP conditions .

  • pH Homeostasis: In Saccharomyces cerevisiae, heterologous expression of plant H+-PPase improved growth under acetic acid stress (pH 3.7) by enhancing intracellular pH regulation .

3.1. Microbial Energy Studies

  • Complementary Role in E. coli: Codon-harmonized hppa from R. rubrum restored PPi hydrolysis in E. coli lacking soluble PPase (S-PPase), confirming functional conservation .

  • ATP Burden Reduction: Engineering S. cerevisiae with Arabidopsis H+-PPase reduced ATP consumption by 35% under industrial stress conditions, enhancing metabolic efficiency .

3.2. Antimalarial Drug Target Validation

PfVP1 in P. falciparum was shown to be essential during the ring-to-trophozoite transition. Knockdown parasites accumulated PPi (2.5-fold increase) and exhibited growth arrest, highlighting its potential as a drug target .

StudyKey Findings
PfVP1 Proton PumpingPPi hydrolysis rate: 1.24 µmol Pi/mg protein/h; ΔpH confirmed via ACMA fluorescence
PPi Sensor AnalysisPPi levels rose to 8.5 nmol/mg protein in PfVP1-deficient parasites

Challenges and Future Directions

  • Stability Issues: Repeated freeze-thaw cycles degrade activity; glycerol (5–50%) is recommended for long-term storage .

  • Industrial Scaling: While H+-PPases reduce ATP dependency in yeast , optimizing expression in non-native hosts remains challenging.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its inclusion in the production process.
Synonyms
hppA1; Pyrophosphate-energized proton pump 1; Membrane-bound proton-translocating pyrophosphatase 1; Pyrophosphate-energized inorganic pyrophosphatase 1; H(+-PPase 1; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Mycoplana dimorpha
Target Names
hppA1
Target Protein Sequence
AIGSAGLGALVLFAAYSNDLSYFAANGDKYPYFANIGEISFDLSNPYVVAGLIFGGLIPY LFGGIAMTAVGRAAGSIVEEVRRQFKEKPGIMQGKDKPNYGRAVDLLTKAAIREMIVPSL LPVLAPLVVYFGVLLISGSKASAFAALGASLLGVIVNGLFVAISMTSGGGAWDNAKKSFE DGFVDKDGQRHMKGSEAHKASVTGDTVGDPYKDTAGPAVNPAIKI
Uniprot No.

Target Background

Function
A proton pump that utilizes the energy derived from pyrophosphate hydrolysis to transport protons across membranes, thereby generating a proton motive force.
Protein Families
H(+)-translocating pyrophosphatase (TC 3.A.10) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary significance of pyrophosphate-energized proton pumps like hppA1?

Pyrophosphate-energized proton pumps (H+-PPases) represent an evolutionarily ancient energy transduction system that has been conserved across diverse organisms including bacteria, archaea, plants, and protists, while being notably absent in fungi and animals. These membrane-bound, single-subunit proton pumps are unique in their utilization of pyrophosphate (PPi) hydrolysis rather than ATP as an energy source for proton translocation across biological membranes. This energy mechanism likely represents one of the earliest bioenergetic systems to evolve, predating the more complex ATP-dependent systems. The preservation of these pumps in organisms like Mycoplana dimorpha and Plasmodium falciparum suggests their continued physiological importance despite the evolution of more complex ATP-driven systems . Their absence in fungi and animals makes them particularly interesting from both evolutionary biology and therapeutic target perspectives, as demonstrated by the essential role of PfVP1 in malaria parasites.

How does the structural composition of hppA1 relate to its function as a proton pump?

The functional architecture of hppA1 consists of a 225-amino acid sequence forming multiple transmembrane domains that create a proton translocation pathway. The protein's structure features an arrangement of 16 transmembrane helices (TMs) organized in two concentric rings—an inner circle formed by TMs 5, 6, 11, 12, 15, and 16, and an outer circle comprising the remaining 10 TMs . This architecture creates a channel through which protons are pumped from the cytosolic side to the luminal side of the membrane. The substrate binding site contains specific amino acids that coordinate with magnesium ions and the pyrophosphate substrate to catalyze hydrolysis. Critical residues for substrate binding have been identified through structural studies, including the inner circle residues that form the proton transfer pathway located at the lower part of this inner transmembrane helix arrangement . This structural organization allows for the coupling of PPi hydrolysis to proton translocation, enabling energy conservation in organisms that express hppA1.

What are the optimal conditions for expressing and purifying functional recombinant hppA1?

Expression and purification of functional recombinant hppA1 requires careful consideration of several parameters to ensure proper protein folding and retention of enzymatic activity. For heterologous expression, E. coli has proven effective for producing full-length hppA1 (such as the 225-amino acid protein from Mycoplana dimorpha) . The expression system should include an N-terminal His-tag to facilitate purification while minimizing interference with protein function. Induction conditions should be optimized at lower temperatures (16-20°C) to promote proper membrane protein folding. For purification, initial extraction using mild detergents that preserve membrane protein structure is critical, followed by metal affinity chromatography using nickel or cobalt resins. The purified protein is typically provided as a lyophilized powder in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 to maintain stability . For reconstitution, the protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL with the addition of 5-50% glycerol for long-term storage. Repeated freeze-thaw cycles should be avoided, and working aliquots should be stored at 4°C for no more than one week . Quality control should include SDS-PAGE analysis to confirm purity (>90%) and functional assays to verify pyrophosphatase activity.

How can researchers effectively measure the proton pumping activity of hppA1 in experimental systems?

Measuring the proton pumping activity of hppA1 requires specialized techniques that can detect proton translocation across membranes. A robust approach involves heterologous expression systems such as Saccharomyces cerevisiae, which lacks endogenous H+-PPases and provides a clean background for functional studies . The methodology includes:

  • Preparation of membrane vesicles: Isolate vacuolar membrane vesicles from yeast expressing recombinant hppA1 using differential centrifugation.

  • Proton gradient measurement: Employ pH-sensitive fluorescent dyes such as acridine orange or ACMA (9-amino-6-chloro-2-methoxyacridine) to monitor proton accumulation inside vesicles. The quenching of fluorescence indicates successful proton pumping.

  • Specificity controls: Compare proton pumping activity in the presence of PPi versus other phosphate compounds (ATP, ADP) to confirm specificity.

  • Inhibitor studies: Use known H+-PPase inhibitors (e.g., imidodiphosphate or aminomethylenediphosphonate) to validate the observed activity.

  • PPi hydrolysis measurement: Complement proton pumping assays with direct measurement of PPi hydrolysis using colorimetric assays for released phosphate or specific PPi sensors.

This multi-faceted approach has been successfully employed to characterize PfVP1 from Plasmodium falciparum and can be adapted for hppA1 from other organisms .

What experimental approaches can be used to investigate the substrate specificity of hppA1?

Investigating the substrate specificity of hppA1 requires a combination of biochemical, structural, and molecular approaches. The following methodological framework provides a comprehensive strategy:

  • Enzymatic activity assays: Compare hydrolysis rates of PPi versus structural analogs (e.g., imidodiphosphate, methylenediphosphonate) using:

    • Colorimetric detection of released phosphate (malachite green assay)

    • Enzyme-coupled assays that link PPi hydrolysis to NADH oxidation

    • Direct monitoring of proton pumping activity as a function of substrate concentration

  • Site-directed mutagenesis: Based on structural information, mutate residues in the substrate binding pocket to alter interactions with PPi. Key residues identified in similar H+-PPases (like PfVP1) include those that coordinate magnesium ions and form hydrogen bonds with the pyrophosphate moiety .

  • Structural biology approaches: Utilize X-ray crystallography or cryo-EM to determine the structure of hppA1 in complex with various substrates and substrate analogs. This can reveal atomic-level details of substrate recognition.

  • Computational approaches: Employ molecular docking and molecular dynamics simulations to predict and analyze substrate binding modes. Hybrid quantum mechanics/molecular mechanics (QM/MM) calculations can further elucidate electronic details of substrate interactions, similar to approaches used for other enzymes .

  • Kinetic analysis: Determine kinetic parameters (Km, Vmax, kcat) for various substrates to quantify specificity differences.

These approaches collectively provide a robust framework for detailed characterization of hppA1 substrate specificity and binding mechanisms.

How can researchers design effective inhibitors for hppA1 based on structural and functional data?

Designing effective hppA1 inhibitors requires a systematic approach leveraging structural insights and functional mechanisms. Based on the available data on H+-PPases, researchers should consider the following strategy:

  • Target identification: Focus on critical regions of hppA1, particularly:

    • The substrate binding pocket that coordinates with magnesium ions and pyrophosphate

    • The proton transfer pathway formed by the inner transmembrane helices

    • Conformational transition sites that mediate the shift between active and inactive states

  • Structure-based design: Utilize the 3D structural information of hppA1 or related H+-PPases. For example, in PfVP1, researchers identified that Gln293 undergoes a significant rotation upon substrate binding, forming a hydrogen bond network (Ser267-Asn282-Gln307-Gln293) that transitions the enzyme from an inactive to an active state . Similar conformational changes in hppA1 could be targeted.

  • Rational inhibitor development: Design compounds that:

    • Mimic the pyrophosphate substrate but resist hydrolysis

    • Block conformational changes required for catalysis

    • Disrupt critical hydrogen bond networks

    • Chelate essential metal cofactors

  • Validation through molecular assays: Test candidate inhibitors using:

    • Enzymatic activity assays measuring PPi hydrolysis and proton pumping

    • Binding affinity studies (ITC, SPR, etc.)

    • Crystallography of enzyme-inhibitor complexes

  • Selectivity assessment: Evaluate inhibitor specificity against related enzymes and human proteins to ensure target selectivity.

This approach has proven successful in developing selective inhibitors for similar enzymes, such as the HPPD inhibitor developed for Arabidopsis thaliana HPPD with a Ki value of 24.10 nM .

What insights can heterologous expression systems provide about the physiological role of hppA1?

Heterologous expression systems offer powerful platforms for elucidating the physiological functions of hppA1 through controlled experimental manipulation. The Saccharomyces cerevisiae system has been particularly valuable because it lacks endogenous H+-PPases, providing a clean background for functional studies . This approach reveals several key physiological insights:

  • Energy conservation mechanism: Expression of functional hppA1 in yeast enables direct measurement of how efficiently the enzyme couples PPi hydrolysis to proton translocation, revealing its role in energy conservation during metabolic conditions where PPi is abundant but ATP is limited.

  • pH homeostasis: By monitoring internal pH changes in vesicles or whole cells expressing hppA1, researchers can quantify its contribution to pH regulation under various metabolic states and stress conditions.

  • Metabolic integration: Using metabolomics approaches in heterologous systems expressing hppA1 reveals how PPi metabolism interfaces with other biochemical pathways, particularly:

    • Glycolysis and gluconeogenesis

    • Nucleic acid synthesis

    • Protein synthesis

    • Lipid metabolism

  • Stress response role: Exposing hppA1-expressing yeast to various stressors (nutrient limitation, pH shifts, temperature changes) reveals how this proton pump contributes to cellular adaptation mechanisms.

  • Evolutionary adaptation: Comparing performance of hppA1 from different species in the same heterologous background provides insights into evolutionary adaptations to specific ecological niches.

Such heterologous systems have successfully demonstrated that PfVP1 from Plasmodium falciparum functions as a genuine PPi-driven proton pump, supporting essential processes during the metabolically challenging ring stage of parasite development .

How does the structure-function relationship of hppA1 compare across different species?

The structure-function relationship of hppA1 exhibits both conserved features and species-specific adaptations across evolutionary lineages. Comparative analysis reveals:

These comparative insights not only illuminate evolutionary adaptations but also provide valuable information for designing species-specific inhibitors for applications in infectious disease control.

What statistical approaches are most appropriate for analyzing hppA1 enzymatic activity data?

Analyzing hppA1 enzymatic activity data requires robust statistical methodologies that account for the complex nature of membrane protein kinetics. Researchers should implement the following approaches:

How can researchers differentiate between direct and indirect effects when studying hppA1 in complex biological systems?

Differentiating between direct and indirect effects of hppA1 in complex biological systems requires a systematic experimental approach combining multiple techniques:

  • Selective inhibition studies:

    • Apply specific hppA1 inhibitors at varying concentrations while monitoring multiple cellular parameters

    • Compare effects with inhibitors of related pathways to establish specificity

    • Implement time-course studies to distinguish primary (rapid) from secondary (delayed) effects

  • Genetic manipulation approaches:

    • Generate conditional knockdowns or knockout systems with complementation

    • Create point mutations affecting specific functions (e.g., catalytic activity vs. protein-protein interactions)

    • Perform rescue experiments with wild-type and mutant variants

  • Multi-omics integration:

    • Combine proteomic, metabolomic, and transcriptomic analyses to map response networks

    • Apply network analysis to identify direct interaction partners versus downstream effectors

    • Use temporal multi-omics to establish causality in response pathways

  • In vitro reconstitution:

    • Recreate minimal systems with purified components to verify direct interactions

    • Progressively add complexity to identify emergent effects

    • Compare kinetics in simple versus complex systems

  • Statistical approaches for causality assessment:

    • Implement Granger causality tests for time-series data

    • Apply structural equation modeling to test hypothesized causal structures

    • Use partial correlation analyses to control for confounding variables

This integrated approach has been successfully applied to dissect the role of PfVP1 in Plasmodium falciparum, revealing its direct function in proton pumping and indirect effects on pH-dependent developmental processes during the ring stage .

What are the best practices for resolving contradictory data in hppA1 research?

When faced with contradictory data in hppA1 research, researchers should implement a systematic resolution framework:

  • Critical evaluation of experimental conditions:

    • Examine differences in protein preparation methods (detergent selection, purification strategy)

    • Compare buffer compositions, focusing on pH, ionic strength, and presence of metal cofactors

    • Assess membrane composition in reconstitution systems, which can significantly impact membrane protein function

    • Document temperature, incubation times, and protein concentrations across studies

  • Methodological cross-validation:

    • Apply multiple independent techniques to measure the same parameter

    • For activity measurements: compare direct (PPi hydrolysis) and indirect (proton pumping) assays

    • For structural studies: cross-validate findings from X-ray crystallography, cryo-EM, and spectroscopic approaches

  • Biological source considerations:

    • Verify the exact organism source and strain identity

    • Account for isoform differences when comparing across studies

    • Consider post-translational modifications that may vary between expression systems

  • Statistical reassessment:

    • Evaluate statistical power and sample sizes in conflicting studies

    • Implement meta-analysis approaches when appropriate

    • Consider Bayesian analysis frameworks to incorporate prior knowledge

  • Collaborative resolution strategy:

    • Establish direct collaboration between labs reporting conflicting results

    • Perform side-by-side experiments with standardized protocols

    • Implement blinded analysis to minimize unconscious bias

This approach acknowledges that experimental design decisions can significantly impact outcomes and that data must be analyzed without bias toward expected results3. When successful, this resolution process not only resolves contradictions but often leads to deeper mechanistic insights about contextual factors affecting hppA1 function.

What emerging technologies could advance our understanding of hppA1 structure and function?

Several cutting-edge technologies are poised to revolutionize our understanding of hppA1:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy with improved detectors and processing algorithms can reveal structural dynamics previously inaccessible

    • Serial femtosecond crystallography using X-ray free-electron lasers (XFELs) can capture transient structural states during the catalytic cycle

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map conformational changes and solvent accessibility at high resolution

  • Single-molecule techniques:

    • Single-molecule FRET to monitor conformational changes during substrate binding and catalysis

    • High-speed atomic force microscopy to visualize structural dynamics in native-like membrane environments

    • Nanodiscs and lipid bilayer systems combined with electrical recordings to correlate structure with proton transport activity

  • Advanced computational approaches:

    • Enhanced sampling molecular dynamics simulations to model conformational transitions

    • Machine learning approaches to predict structure-function relationships from sequence data

    • Quantum mechanics/molecular mechanics (QM/MM) calculations to model the electronic details of PPi hydrolysis and proton transport, similar to approaches used for related enzymes

  • Synthetic biology and in vivo sensors:

    • Genetically encoded fluorescent biosensors for PPi and pH to monitor hppA1 activity in living cells

    • Optogenetic control systems to modulate hppA1 activity with spatiotemporal precision

    • Cell-free expression systems for rapid prototyping of hppA1 variants

  • Multi-scale integration:

    • Correlative light and electron microscopy to link cellular localization with structural features

    • Integrative structural biology combining multiple data types into unified models

    • Systems biology approaches connecting molecular mechanisms to cellular phenotypes

These technologies will enable researchers to address fundamental questions about the coupling mechanism between PPi hydrolysis and proton transport, regulatory mechanisms, and physiological roles of hppA1 in different organisms.

How might hppA1 research inform the development of novel antimalarial strategies?

The research on pyrophosphate-energized proton pumps has significant implications for antimalarial drug development, particularly through insights gained from studies of PfVP1 in Plasmodium falciparum:

  • Target validation evidence:

    • PfVP1 has been confirmed as an essential enzyme during the ring stage of P. falciparum development, when the parasite relies on PPi as an energy source

    • The absence of H+-PPases in humans makes PfVP1 an attractive target with potential for high selectivity and reduced side effects

  • Drug development strategies:

    • Structure-based design targeting the unique substrate binding pocket of PfVP1

    • Inhibitors preventing conformational changes required for enzyme activation, similar to the approach used for HPPD inhibition

    • Allosteric inhibitors disrupting the hydrogen bond networks critical for enzyme function

    • Combination therapy approaches targeting multiple stages of the parasite life cycle

  • Resistance management considerations:

    • Understanding the evolutionary constraints on H+-PPases to predict potential resistance mechanisms

    • Developing inhibitors with high barriers to resistance by targeting highly conserved structural elements

    • Combination strategies targeting both PfVP1 and other essential pathways

  • Translational research framework:

    • Heterologous expression systems for high-throughput screening of potential inhibitors

    • Structure-activity relationship studies to optimize lead compounds

    • Transgenic parasite lines for target validation and resistance studies

    • Animal models to evaluate efficacy and pharmacokinetics of promising candidates

  • Broader applications:

    • Extended targeting of H+-PPases in other protozoan parasites causing neglected tropical diseases

    • Potential agricultural applications against plant pathogens that rely on similar enzymes

The research on PfVP1 has already demonstrated that PPi serves as an energy source in malaria parasites, particularly during the metabolically challenging ring stage when ATP supply is limited . This unique energy utilization strategy represents a vulnerability that could be exploited for next-generation antimalarial therapeutics.

What are the most significant unanswered questions in the field of pyrophosphate-energized proton pumps?

Despite significant advances, several fundamental questions about pyrophosphate-energized proton pumps remain unresolved:

  • Mechanistic coupling questions:

    • What is the precise molecular mechanism coupling PPi hydrolysis to proton translocation?

    • How many protons are transported per PPi molecule hydrolyzed, and what determines this stoichiometry?

    • What conformational changes occur during the catalytic cycle, and how are they coordinated?

  • Evolutionary inquiries:

    • How did H+-PPases evolve relative to other bioenergetic systems like the F-type and V-type ATPases?

    • Why have H+-PPases been retained in some lineages but lost in others (fungi and animals)?

    • What selective pressures drive the divergence between Type I (K+-dependent) and Type II (Ca2+-dependent) H+-PPases?

  • Regulatory mechanisms:

    • How is hppA1 activity regulated in response to changing metabolic conditions?

    • What post-translational modifications modulate enzyme function?

    • How do membrane lipid composition and physical properties affect enzyme activity?

  • Physiological integration:

    • How do organisms integrate the activities of PPi-dependent and ATP-dependent proton pumps?

    • What metabolic conditions favor the utilization of PPi versus ATP as an energy source?

    • How do pyrophosphate-energized proton pumps contribute to pH homeostasis under different stress conditions?

  • Structural biology challenges:

    • What is the complete conformational landscape of H+-PPases throughout the catalytic cycle?

    • How do substrate binding and product release events trigger conformational changes?

    • What is the structural basis for the differing cation dependencies observed across H+-PPase types?

Addressing these questions will require integrated approaches combining structural biology, biochemistry, biophysics, and cellular physiology. The answers will not only advance our fundamental understanding of these ancient energy transduction systems but also inform applications in medicine, agriculture, and biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.