Recombinant Pyrophosphate-energized proton pump (hppA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
hppA; Pyrophosphate-energized proton pump; Membrane-bound proton-translocating pyrophosphatase; Pyrophosphate-energized inorganic pyrophosphatase; H(+-PPase; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Anaplasma marginale
Target Names
hppA
Target Protein Sequence
NGSIMGALYKGLIATGLLSIVGLGVANTLTVGWGEIGTVAGKSITGTNLFVCGLIGLIVT GLIVVITEYYTGTNKRPVNSXAQASVTGHGTNVIQGLAVSLESTALPAIVIVGGIIXTYQ LAGLFGTAIAVTAMLGIAGMI
Uniprot No.

Target Background

Function
A proton pump that utilizes pyrophosphate hydrolysis to drive proton translocation across membranes, generating a proton motive force.
Protein Families
H(+)-translocating pyrophosphatase (TC 3.A.10) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is hppA and what distinguishes it from other pyrophosphatases?

H+-PPase (hppA) is a membrane-bound proton-translocating pyrophosphatase that couples the hydrolysis of inorganic pyrophosphate (PPi) with proton transport across membranes. Unlike soluble cytoplasmic pyrophosphatases (S-PPases) that simply hydrolyze PPi and release energy as heat, H+-PPase conserves part of this energy in the form of a proton electrochemical gradient that can be used for ATP synthesis . This fundamental difference provides organisms expressing hppA with a bioenergetic advantage, as they can utilize the high-energy bonds of PPi released during cellular processes for proton pumping and subsequent energy generation .

The hppA protein consists of a transmembrane structure that forms a channel through which protons are translocated during PPi hydrolysis. The membrane-bound nature of hppA is critical to its function, as it allows for the establishment of proton gradients across cellular membranes .

What approaches are used to express recombinant hppA in bacterial systems?

Expression of recombinant hppA typically involves several key steps:

  • Gene optimization: Codon harmonization of the hppA gene to match the host organism's preferences. For example, when expressing H+-PPase Rru in E. coli, the gene is typically codon-harmonized to improve expression .

  • Vector selection: Various expression vectors can be used, such as the pET series, which contain the T7 promoter system for high-level expression in E. coli . Selection of an appropriate vector is crucial for successful expression of functional recombinant protein.

  • Chromosomal integration: For stable expression, the hppA gene can be integrated into the host chromosome. This is achieved using integrative vectors like pAH162-TcR-2Ter, which can be used for φ80-mediated integration into the artificial φ80-attB site on the chromosome of E. coli .

  • Expression conditions optimization: Factors such as temperature, inducer concentration, media composition, and induction time need to be optimized for efficient expression of functional hppA .

How can researchers design experiments to optimize expression of functional recombinant hppA?

Optimal expression of recombinant hppA requires a multifactorial experimental design approach. Researchers should consider implementing:

Statistical Experimental Design Methodology:
Rather than traditional univariant methods (changing one variable at a time), multivariant approaches allow for the evaluation of multiple variables simultaneously while considering interactions between them . This approach provides:

  • More thorough analysis

  • Characterization of experimental error

  • Higher quality information with fewer experiments

  • Ability to compare variable effects when normalized

A fractional factorial screening design can be particularly effective, where multiple variables are tested at different levels with central point replicates . For hppA expression, key variables to consider include:

Variable CategoryParameters to Optimize
Media CompositionCarbon source, nitrogen source, salt concentration, pH
Induction ConditionsInducer concentration, induction time, induction temperature
Host StrainDifferent E. coli strains (BL21(DE3), Rosetta, C41/C43)
Vector DesignPromoter strength, ribosome binding site efficiency

An example optimization algorithm would include:

  • Initial selection of training samples (n=20) randomly from parameter space

  • Determination of the MLE (Maximum Likelihood Estimate) of parameters

  • Calculation of utility functions based on observed information matrices

  • Selection of optimal design points through grid search

  • Selection of experimental conditions closest to optimal design

  • Updating parameter estimates and repeating the process

This approach has demonstrated success in achieving up to 2-fold improvements in expression efficiency compared to random parameter selection .

What methods can be used to verify the functionality of expressed recombinant hppA?

Verifying the functionality of recombinant hppA requires multiple analytical approaches:

  • Complementation assays: Demonstrating that H+-PPase Rru can complement the essential native S-PPase in E. coli cells. This can be achieved by replacing the native soluble cytoplasmic E. coli PPase with membrane-bound H+-PPase Rru and confirming cell viability .

  • Proton pumping activity measurements: Direct measurement of proton translocation across membranes using pH-sensitive fluorescent dyes or electrodes to confirm H+-PPase activity.

  • Metabolic flux analysis: Implementing 13C-MFA (13C-metabolic flux analysis) to detect shifts in carbon flux distribution resulting from H+-PPase Rru expression. Research has shown that replacing native PPase with H+-PPase Rru leads to a statistically significant 36% decrease in tricarboxylic acid (TCA) cycle fluxes compared with wild-type E. coli MG1655 .

  • ATP production assessment: Measuring intracellular ATP levels to confirm the bioenergetic advantage conferred by H+-PPase expression.

  • Membrane localization confirmation: Using fluorescence microscopy or membrane fractionation followed by Western blotting to confirm proper localization of the expressed H+-PPase to the membrane.

How does heterologous expression of hppA affect cellular metabolism and what analytical methods should be used to characterize these changes?

Heterologous expression of hppA significantly impacts cellular metabolism, particularly energy-generating pathways. These effects can be characterized through:

Metabolic Flux Analysis (13C-MFA):
13C-MFA is particularly valuable for characterizing the metabolic impacts of hppA expression. Studies have shown that replacing native PPase with H+-PPase Rru leads to:

  • 36% decrease in TCA cycle fluxes compared to wild-type E. coli

  • Redistribution of carbon fluxes, indicating an additional method for energy generation (ATP)

Comparative Metabolic Data Table:

Metabolic ParameterWild-type E. coliE. coli expressing hppAPercent Change
TCA cycle fluxNormal (baseline)Decreased-36%*
ATP productionNormal (baseline)IncreasedVaries**
Carbon flux distributionStandard patternRedirectedSignificant***

*Statistically significant (p < 0.05)
**Dependent on growth conditions and carbon source
***Measurable by 13C-MFA techniques

The redistribution of metabolic fluxes when expressing H+-PPase suggests that cells can utilize the energy from PPi hydrolysis for ATP generation, which could be particularly advantageous for bioprocesses requiring high ATP consumption .

What are the challenges in purifying functional membrane-bound hppA and how can these be addressed?

Purification of membrane proteins like hppA presents several challenges:

  • Solubilization issues: Membrane proteins require detergents for extraction from the membrane, which can affect protein stability and activity.

  • Maintaining native conformation: The functional state of hppA depends on proper folding and insertion into membranes.

  • Aggregation tendency: Membrane proteins often aggregate when removed from their lipid environment.

Methodological approaches to address these challenges:

  • Fusion tags optimization: Incorporating appropriate fusion tags can improve solubility and facilitate purification. Common approaches include:

    • N-terminal 6×His tag for IMAC purification

    • TAT-HA tags for potential cell penetration applications

    • EGFP or mCherry fusion for monitoring expression and localization

  • Immobilized metal affinity chromatography (IMAC): Using Ni-NTA columns for purifying His-tagged hppA is effective when combined with appropriate detergent conditions .

  • Detergent screening: Systematic testing of different detergents (non-ionic, zwitterionic) at varying concentrations to identify optimal solubilization conditions that preserve protein activity.

  • Buffer optimization: Adjusting pH, salt concentration, and including stabilizing agents (glycerol, specific lipids) to maintain protein stability during purification.

  • Scale-up considerations: Implementing statistical design of experiments (DoE) approaches for optimizing large-scale purification parameters while minimizing resource usage .

How can researchers apply probabilistic analysis to optimize hppA expression systems?

Probabilistic analysis, also referred to as probabilistic sensitivity analysis (PSA), can be a powerful tool for optimizing complex expression systems like those required for hppA:

  • Parameter uncertainty quantification: Identifying key variables in the expression system (temperature, inducer concentration, media composition) and their probability distributions based on preliminary experiments.

  • Monte Carlo simulations: Running multiple simulations with randomly sampled parameter values to identify robust operating conditions that produce consistent results despite inherent variability .

  • Cost-effectiveness assessment: Evaluating the trade-offs between expression levels, protein functionality, and resource utilization to determine the most efficient production strategy.

  • Value of information analysis: Determining which experimental parameters provide the most valuable information for optimization, directing resources toward the most influential variables .

Implementation approach:

  • Define probability distributions for key parameters based on literature and preliminary experiments

  • Conduct Monte Carlo simulations (≥1000 iterations) to explore parameter space

  • Calculate credible intervals (95%) for expression outcomes

  • Identify parameter combinations that maximize desired outcomes while minimizing variability

  • Use sensitivity analysis to determine parameters with greatest impact on outcomes

This approach allows researchers to develop robust expression protocols that account for intrinsic biological variability and parameter uncertainty, leading to more reproducible and scalable production of functional hppA.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.